SKU: 99976638778

Axl His Tag Protein, Mouse

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 7 - Sep 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Axl His Tag Protein, MouseProduct Specification Species Mouse Synonyms Axl, UFO, Tyro7, JTK11, ARK Accession Q00993 Amino Acid Sequence His20 Pro443, with C terminal 10*His

Product Specification


Species Mouse
Synonyms Axl, UFO, Tyro7, JTK11, ARK
Accession Q00993
Amino Acid Sequence His20-Pro443, with C-terminal 10*His HKDTQTEAGSPFVGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 60-78kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Weinger J G. et al. (2011) Loss of the receptor tyrosine kinase Axl leads to enhanced inflammation in the CNS and delayed removal of myelin debris during Experimental Autoimmune Encephalomyelitis. J Neuroinflammation. 8: 49.

2、Linger R M. et al. (2010) Taking aim at Mer and Axl receptor tyrosine kinases as novel therapeutic targets in solid tumors. Expert Opin Ther Targets. 14(10): 1073-1090.

3、Cavet M E. et al. (2010) Gas6-Axl pathway: the role of redox-dependent association of Axl with nonmuscle myosin IIB. Hypertension. 56(1): 105-111.

4、Rankin E B. et al. (2010) AXL is an essential factor and therapeutic target for metastatic ovarian cancer. Cancer Res. 70(19): 7570-7579.

Background

AXL Receptor Tyrosine Kinase is also known as Tyrosine-protein kinase receptor UFO, which belongs to the protein kinase superfamily, Tyr protein kinase family and AXL/UFO subfamily. Mature human Axl consists of a 426 aa extracellular domain (ECD) that contains two Ig-like domains and two fibronectin type III domains, a 21 aa transmembrane segment, and a 422 aa cytoplasmic domain that includes the tyrosine kinase domain. In the nervous system, Axl and its ligand Growth-arrest-specific protein 6 (Gas6) are expressed on multiple cell types. Axl functions in dampening the immune response, regulating cytokine secretion, clearing apoptotic cells and debris, and maintaining cell survival. Axl is upregulated in various disease states, such as in the cuprizone toxicity-induced model of demyelination and in multiple sclerosis (MS) lesions, suggesting that it plays a role in disease pathogenesis. The receptor tyrosine kinase (RTK) AXL has been associated with poor prognosis in numerous malignancies and the emergence of therapy resistance. Upon binding to its ligand GAS6, AXL regulates cell signaling cascades and cellular communication between various components of the tumor microenvironment, including cancer cells, endothelial cells, and immune cells. Converging evidence points to AXL as an attractive molecular target to overcome therapy resistance and immunosuppression, supported by the potential of AXL inhibitors to improve ICI efficacy. Axl contributes to cell survival, migration, invasion, metastasis and chemosensitivity justify further investigation of Axl as novel therapeutic targets in cancer. The soluble AXL receptor as a therapeutic candidate agent for treatment of metastatic ovarian cancer.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 99976638778

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Genevieve M
Waukegan, US
★★★★★ 5
Great puppy teething toy!
My bernedoodle loved this toy. Long after all her teeth had fallen out, she still plays with it! It was great to be able to freeze it and let her gnaw on something that would help her feel a little better too! We both agree that this was extremely helpful and fun!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2023
A
Verified Purchase
AmazonCustomer
Charlottesville, US
★★★★★ 3
Golden Retriever puppy did not care for it but other breeds very well might
These seem to be very well made but our Goiden Retriever puppy was only interested in it for less than one minute. Before you buy i would scan the great reviews to see what breeds these really appeal to. I am sure there are some!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
L
Verified Purchase
Leslie
Battle Creek, US
★★★★★ 5
Puppy Love!
My puppy loves hers! Frozen or not, one of her favorite chew toys
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 2, 2025
D
Verified Purchase
D mat
Natrona Heights, US
★★★★★ 1
Smells of smoke
The plastic smells of tobacco smoke, my puppy took one stiff and walked away. I wash them with soap trying to get the smell to go away, no change. My dog still would not even try to teethe on this. I do not recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2024
N
Verified Purchase
Nichole McKeever
Carnegie, US
★★★★★ 5
Wonderful teething toys for small teeth!
We bought these for our new three chihuahua babes and they love them so much! For now, since the babies still get really cold, we just do them as is and are going to hold off on freezing them for a bit but it's still great! They love to chew on either end and the different textures of both the rag and the different ones on the bone itself, keep them really entertained.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 25, 2022

recommand products