SKU: 47176477191

Fc epsilon RI α Fc Chimera Protein, Human

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 7 - Sep 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Fc epsilon RI α Fc Chimera Protein, HumanProduct Specification Species Human Antigen Fc epsilon RI Accession P12319 1 Amino Acid Sequence Val 26 Leu204, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen Fc epsilon RI
Accession P12319-1
Amino Acid Sequence

Val 26-Leu204, with C-terminal Human IgG1 Fc

VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLGGGSGGGSPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 65-72kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fc epsilon RI, the high-affinity IgE receptor, distinguishes Ag-IgE interactions and drives cellular allergic responses. Fc epsilon RI is primarily expressed on MCs, basophils and Ag-presenting cells, and mainly exists as the heterotetramer αβγ2. However, there are differences among species: an alternate trimeric form αγ2 is expressed on human, but not rodent. Structurally, it is composed of one α-chain bearing two extracellular immunoglobulin domains that bind to the Fc portion of a single molecule of IgE, a β-chain that holds an immunoreceptor tyrosine-based activation motif (ITAM), and a homodimer of disulfide-bound ITAM-containing γ-chains. Expression of the β chain in mast cells and basophils results in increased Fc epsilon RI surface expression and amplifies signaling through the receptor. The importance of the α-subunit in the Fc epsilon RI-mediated allergic reaction was demonstrated by the absence of allergic reactions in α-subunit-deficient mice. The Fc epsilon RIα binds to the Fc fragment of IgE at a 1:1 ratio to form the IgE-Fc complex. Fc epsilon RI is a unique molecular target that initiates different functional outcomes of MC responses and allergic inflammation. The recognition of multivalent antigen by Fc epsilon RI-bound IgE triggers a complex biochemical pathway initiated by the phosphorylation of ITAM motifs by the Src family kinase Lyn. Fc epsilon RI not occupied by IgE has a half-life on the mast cell surface of 24 hours in vitro, while receptors bound to IgE appear to be expressed for the life of the cell. The density of human basophil FcεR1 expression correlates directly with serum IgE levels, where binding of IgE stabilizes the receptor at the cell surface.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 47176477191

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Fan
Houston, US
★★★★★ 5
Highly recommend.
Style: Sport, Size: 12in
Love this. Dog sitting for a dog that loves to chase balls but my shoulder doesn’t like throwing them. Got this yesterday and it’s perfect. Real arm/shoulder saver. Seems sturdy and I was concerned that a standard tennis ball would not work. We tend to lose balls when walking because this lab insists on carrying the ball in its mouth. They work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
D
Verified Purchase
Dobelvr
San Leandro, US
★★★★★ 5
These are awesome and I couldn't play ball with my Dobermans without it!
Style: Sport, Size: 12in
I LOVE Chuckit ball launchers. We've been using for a around 17 years and we've only had to replace one. We have 2 active, energetic Dobermans and I throw like a girl and there is now way I can throw a ball very far. With the Chuckit, I can throw more than 80 feet! My dogs need a lot of exercise and using this ball thrower allows me to make that happen. Bonus is I dont have to pick up a snobbery ball :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
E
Verified Purchase
Eddie R.
San Leandro, US
★★★★★ 4
Not a long shot
Style: Sport, Size: 12in
This item is much smaller than I thought it would be . The ball is full sized . But the thrower is very small. Works okay. But does not throw the ball very far . It’s okay for me . My dogs are small. My yard is too . But , this is not going to throw balls really far . Like the long ones do Thsnks Eddie
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
A
Verified Purchase
Amazon Customer
Cuba, US
★★★★★ 5
Perfect addition
Style: Sport, Size: 12in
This is item that I needed but didnt know it. Its been great for saving my sholder anad my dog loved the longer chase to get the ball. Easy to use and lots of fun
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
J
Verified Purchase
Jaclyn P.
Charlottesville, US
★★★★★ 5
I would buy this twice!
Style: Sport, Size: 12in
This Chuckit! Dog Ball Launcher 12M Sport is the perfect product for the dog park! It makes games of fetch so much easier and more fun — the long handle gives great reach, so I can launch balls super far without even bending over, and our dog goes absolutely wild chasing them. It’s comfortable to hold, works smoothly with 2.5" dog balls, and really saves your arm and back if you’re doing a lot of throwing. The design is sturdy and reliable, so we can play for longer without worrying about it snapping or wearing out. If you spend time at the dog park or love playing fetch, this launcher turns a regular game into something even better — our pup gets twice the exercise and we get to enjoy every minute of playtime!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2026

recommand products