SKU: 25483622402

Her3 His Tag Protein, Human

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 7 - Sep 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Her3 His Tag Protein, HumanProduct Specification Species Human Synonyms Her3, FERLK, LCCS2, VSCN1 Accession P21860 Amino Acid Sequence Ser20 Thr643, with C terminal 10*His

Product Specification


Species Human
Synonyms Her3, FERLK, LCCS2, VSCN1
Accession P21860
Amino Acid Sequence

Ser20-Thr643, with C-terminal 10*His SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

80-95kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Zhang N. et al. (2016) HER3/ErbB3, an emerging cancer therapeutic target. Acta Biochim Biophys Sin. 48(1): 39-48.

Background

HER3 is a member of the HER (EGFR/ErbB) receptor family consisting of four closely related type 1 transmembrane receptors (EGFR, HER2, HER3, and HER4). HER receptors are part of a complex signaling network intertwined with the Ras/Raf/MAPK, PI3K/AKT, JAK/STAT, and PKC signaling pathways. Aberrant activation of the HER receptors and downstream signaling molecules tips the balance on cellular events, leading to various types of cancers. The HER3 protein is expressed in several types of tumors. That fact, together with the role of HER3 in promoting cell proliferation, implicate that targeting HER3 may have therapeutic relevance. Furthermore, expression and activation of HER3 has been linked to resistance to drugs that target other HER receptors such as agents that act on EGFR or HER2.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 25483622402

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Alexandria, US
★★★★★ 5
Great buy, finally a big soft toy, and so cute
Color: Green
This octopus toy is so adorable, I’m truly so impressed with the size finally a big toy for a big dog. She loves it! It squeaks, soft, made great. Worth it! Love it! Fun, durable n chewability just for play materials soft n durable. It’s a sea foam green color and creme beautiful neutral color
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026
K
Verified Purchase
Kay-Z
Grantham, US
★★★★★ 5
Large, excellent toy with many squeakers!
Color: Blue, Color: Blue
This toy is excellent! I’m super happy with this purchase. My dog loves squeakers and there are so many in this toy, plus stuffing for her to rip out, and crinkle paper to take the sensory experience up another notch! It’s also more durable than many other plush-type dog toys, and is larger than expected which is a plus in my book. For size reference, both dogs are around 40lbs. I will be buying another as soon as this one is demolished!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
B
Verified Purchase
Birdofsong
Louisville, US
★★★★★ 5
Huge and fun. Good for two dogs to play with together.
Color: Yellow
This dog toy is great! And it's HUGE. Each tentacle crinkles, and the dogs love to play tug-of-war with it. It seems to be holding up well, too. It seemed a bit pricy for a dog toy, but it turns out it was worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2026
M
Verified Purchase
MissyP
Alexandria, US
★★★★★ 5
My dogs new favorite toy!
Color: Blue
His new favorite toy! My dog absolutely loves it!!! It’s much bigger than I thought it would be so my dog has to be careful when he’s running with it because he will trip on the legs of the octopus. The best part is there is a little squeaker in the bottom of each leg! Bonus!!! If your dog chews up stuffed animals, this will be no different. It is a stuffed animal. My baby just likes to carry it around and squeak it a 1000 times a day. Don’t mind my crazy voice in the video. That’s the voice I use when he’s excited about a toy. He greets me every day with his octopus.🥰
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 13, 2026
A
Verified Purchase
Amazon Customer
Dallas, US
★★★★★ 4
Fun while they lasted
Color: Green
I ordered two. One for each pup. Both my puppies loved this toy. The first one lasted less than a day with my pup who loves to do the death shake on everything. The second lasted two days with the other as she chews in the same spot. They loved the crinkle noise. However, I'm taking one star away due to not lasting long. Everything else was fine and they enjoyed them while they lasted. Note that most toys do not last long with my pups.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026

recommand products