SKU: 9419656867

CD40 His Tag Protein, Mouse

Sale price$234.00 Regular price$260.00
Save 10%

Pay in installments of $65.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD40 His Tag Protein, MouseProduct Specification Species Mouse Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5, p50 Accession P27512 Amino Acid Sequence Val24 Arg193, with C terminal 8*His VTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRGGGSHHHHHHHH Expression System HEK293 Molecular Weight 22 27kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Mouse
Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5, p50
Accession P27512
Amino Acid Sequence Val24-Arg193, with C-terminal 8*His VTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 22-27kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Chatzigeorgiou A. et al. (2009) CD40/CD40L signaling and its implication in health and disease. Biofactors. 35(6): 474-483.

2、Li R. et al. (2009) Expression of CD40 and CD40L in Gastric Cancer Tissue and Its Clinical Significance. Int J Mol Sci. 10(9): 3900-3917.

3、Lievens D. et al. (2009) The multi-functionality of CD40L and its receptor CD40 in atherosclerosis. Thromb Haemost. 102(2): 206-214.

Background

CD40 is also known as TNFRSF5, Bp50, CDW40, MGC9013, TNFRSF5 and p50, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins, and plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on TH cells to CD40 activates antigen presenting cells and induces a variety of downstream effects. CD40 contains 4 cysteine-rich repeats in the extracellular domain, and is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines. Interaction of CD40 with its ligand, CD40L, leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Early studies on the CD40-CD40L system revealed its role in humoral immunity. Both CD40 and CD40 L have a membrane form and a soluble form generated by proteolytic cleavage or alternative splicing. CD40 and CD40L are widely expressed in various types of cells, among which B cells and myeloid cells constitutively express high levels of CD40, and T cells and platelets express high levels of CD40L upon activation. CD40L self-assembles into functional trimers which induces CD40 trimerization and downstream signaling. CD40/CD40L immune checkpoint leads to activation of both innate and adaptive immune cells via two-way signaling. CD40/CD40L interaction also participates in regulating thrombosis, tissue inflammation, hematopoiesis and tumor cell fate. The mechanisms of benefits include immune cell activation and tumor cell lysis/apoptosis in malignancies, or immune cell inactivation in autoimmune diseases and allograft rejection.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9419656867

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Denisse Hdez
Dallas, US
★★★★★ 5
Is does the job, love it.
Size: 60% Compact
Is really comfy, it does the job, you can't go wrong with it. Just buy it if you have a 75% keyboard or less because is not long. For me is not a problem.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
T
Verified Purchase
Timothy Porter
Whiting, US
★★★★★ 5
Nice wrist rest
Size: 100% Standard
Comfortable angle, solid enough to not move around but soft enough to be good for long term usage.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
T
Verified Purchase
Tonya
Boise, US
★★★★★ 5
Comfortable Rest
Size: Keyboard Wrist Rest (Pack of 1), Style: Slim & Compact
Great product for resting hand as you work, handling tasks or typing reports or checking emails!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2026
A
Verified Purchase
All for a Fool
Waukegan, US
★★★★★ 5
Fits Magic Keyboard Perfectly
Size: Keyboard Wrist Rest (Pack of 1), Style: Slim
This is exactly the length of the Magic Keyboard and it is low to the ground. I did buy a thing that angles the Magic Keyboard slightly upwards in the back so it has a small angle and then I have this wrist rest. It is wonderful. I am so glad after all the digging and looking I found this one and bought it. I took it out of the box and didn't remove the paper on the back to make sure I liked it. I do, I love it. It is not only comfortable, it looks sleek, fits exactly and I don't get sore after hours upon hours of typing. The quality is good. I have zero complaints and feel lucky this is the first one I chose as it hit the mark.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 6, 2025
X
Verified Purchase
XanetiaZ
Lowell, US
★★★★★ 5
Comfortable Wrist Rest for larger laptops.
Size: Keyboard Wrist Rest (Pack of 1), Style: Mechanical & Gaming
I bought this to use with my new 17 inch MSI gaming laptop. I was getting a very sore wrist as the laptop is pretty tall. This is tall enough that it is preventing the strain on the wrist. It is comfortable and not too hard, but firm enough to support my wrists. It is long enough to fit the entire length of my laptop without being too long. The curved shape puts the extra padding on the left side where I use it most for the WASD keys, but also gives me padding on the right for when I am typing and need it there also. It has a strong durable feel to it, but is smooth and soft. The bottom is shiny and rubbery and grips my lapdesk so that it does not slip and stays right where I place it. It appears to be well constructed, and considering the price, I would expect nothing less. I am very happy with this purchase and would recommend it to anyone with a large laptop or gaming keyboard.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 20, 2017

recommand products