SKU: 46327028956

ROBO4 His Tag Protein, Mouse

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ROBO4 His Tag Protein, MouseProduct Specification Species Mouse Antigen ROBO4 Synonyms roundabout, axon guidance receptor, homolog 4 (Drosophila) Accession Q8C310 Amino Acid Sequence Leu28 Glu470, with C terminal 8*His

Product Specification


Species Mouse
Antigen ROBO4
Synonyms roundabout, axon guidance receptor, homolog 4 (Drosophila)
Accession Q8C310
Amino Acid Sequence

Leu28-Glu470, with C-terminal 8*His

LDSPPQILVHPQDQLLQGSGPAKMRCRSSGQPPPTIRWLLNGQPLSMATPDLHYLLPDGTLLLHRPSVQGRPQDDQNILSAILGVYTCEASNRLGTAVSRGARLSVAVLQEDFQIQPRDTVAVVGESLVLECGPPWGYPKPSVSWWKDGKPLVLQPGRRTVSGDSLMVSRAEKNDSGTYMCMATNNAGQRESRAARVSIQESQDHKEHLELLAVRIQLENVTLLNPEPVKGPKPGPSVWLSWKVSGPAAPAESYTALFRTQRSPRDQGSPWTEVLLRGLQSAKLGGLHWGQDYEFKVRPSSGRARGPDSNVLLLRLPEQVPSAPPQGVTLRSGNGSVFVSWAPPPAESHNGVIRGYQVWSLGNASLPAANWTVVGEQTQLEIATRLPGSYCVQVAAVTGAGAGELSTPVCLLLEQAMEQSARDPRKHVPWTLEQLRATLRRPEGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 60-75kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Xiao, W., Pinilla-Baquero, A., Faulkner, J. etal. Robo4 is constitutively shed by ADAMs from endothelial cells and the shedRobo4 functions to inhibit Slit3-induced angiogenesis. Sci Rep 12, 4352 (2022).https://doi.org/10.1038/s41598-022-08227-8.

Background

Roundabout homolog 4, also known as magic roundabout and ROBO4 is a member of the immunoglobulin superfamily and ROBO family.Roundabout 4 (Robo4) is a transmembrane receptor that expresses specifically in endothelial cells. ROBO4 contains two fibronectin type-III domains and two Ig-like C2-type (immunoglobulin-like) domains.     ROBO4 is predominantly expressed in embryonic or tumor vascular endothelium and is considered important for vascular development and as a candidate tumor endothelial marker.  ADAM10 and ADAM17 are abscisic enzymes of Robo4, and the negative regulation of their ligand Slit3 is a new control mechanism of Robo4 signaling in angiogenesis.


Protocol

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 46327028956

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cody
Omaha, US
★★★★★ 1
Not for aggressive chewers!
Color: H) Infinity Ring, Color: H) Infinity Ring
Not for aggressive chewers! Done for in about two minutes. I unboxed this and tugged with my Mal for a but then let her have it. Within minutes she had chewed through it. Not worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
N
Verified Purchase
Nicole Lomonaco
Belleville, US
★★★★★ 4
Dog ball
Color: A) Small 2.5" Ball
My dog enjoys but smaller than expected
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
A
Verified Purchase
Amy
Battle Creek, US
★★★★★ 5
Great tough ball
Color: A) Small 2.5" Ball
Great ball for dogs who like to destroy most any ball. Our girl loves this. Yay!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026
C
Verified Purchase
Christopher D Smith
Boise, US
★★★★★ 3
Not Quite So Durable...
Color: B) Medium 3" Ball, Color: B) Medium 3" Ball
Maybe I have a SUPER aggressive chewer...he went through this ball in under a week. I originally bought the ball because of a review that stated the owner's Pitbull had the same ball for two years; not so much for my Rottweiler. He started chewing off and swallowing small crumbs from the ball within a day or two. By the end of the week, it was chunks so I had to toss it in the trash to prevent an intestinal obstruction. On the up side, my Rottweiler LOVED the ball while it lasted. However, I can't, in good conscience, give this ball a rave review based on this experience. Please take this review with a grain of salt as I have yet to find ANY toy that my boy won't DESTROY in a week or two. I hope that someone finds this informative when searching for chew toys for SUPER aggressive chewers like mine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026
J
Verified Purchase
jewelrycook
Bozeman, US
★★★★★ 5
Bouncy, not hard, and good value.
Style: Fetch Balls (Pack of 10), Size: 2.5 inch
Great balls for the ball launcher and not rockhard like some of the solid rubber balls. These have great bounce, and because of the two holes, they make a fun whistling noise as they fly through the air. My dogs love them and they are a good value. By the way, if you throw them too hard, they will go through chain-link and no climb fence because they squish a bit!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2026

recommand products