SKU: 52795669307

Frizzled-5/FZD5 His Tag Protein, Human

Sale price$184.50 Regular price$205.00
Save 10%

Pay in installments of $51.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Frizzled-5/FZD5 His Tag Protein, HumanProduct Specification Species Human Synonyms Frizzled 5, FZD5, C2orf3, Fz 5, hFz5, FzE5 Accession Q13467 Amino Acid Sequence Ala27 Pro167, with C terminal 8*His ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 33kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Human
Synonyms Frizzled-5, FZD5, C2orf3, Fz-5, hFz5, FzE5
Accession Q13467
Amino Acid Sequence Ala27-Pro167, with C-terminal 8*His ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 25-33kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Sun Y. et al. (2020) FZD5 contributes to TNBC proliferation, DNA damage repair and stemness. Cell Death and Disease. 11: 1060.

Background

FZD5, a member in Frizzled family, was identified to be preferentially expressed in TNBC (triple-negative breast cancer), and associated with unfavorable prognosis. Loss and gain of function studies revealed that FZD5 contributed to TNBC cell G1/S transition, DNA replication, DNA damage repair, survival, and stemness. Mechanistically, transcription factor FOXM1, which promoted BRCA1 and BIRC5 transcription, acted as a downstream effecter of FZD5 signaling. FOXM1 overexpression in FZD5-deficient/low TNBC cells induced FZD5-associated phenotype. Finally, Wnt7B, a specific ligand for FZD5, was shown to be involved in cell proliferation, DNA damage repair, and stemness. Taken together, FZD5 is a novel target for the development of therapeutic strategies to overcome chemoresistance and prevent recurrence in TNBC.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 52795669307

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Parrot 64
Chelsea, US
★★★★★ 4
Good quality, although expensive
Size: 1 Count (Pack of 1), Style: Cartridge Ink
Frankly, as with other printers, I thought that I could use reconditioned cartridges with this printer. The first set I purchased was not recognized, thus I have had to purchase genuine products. The cartridges, also offering good color, do not last long. It's a trade-off between cost and quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 10, 2020
R
Verified Purchase
Ree Bee
Natrona Heights, US
★★★★★ 5
Epson cartridges
Size: 1 Count (Pack of 1), Style: Cartridge Ink
I have an Epson 1500 and I use Epson cartridges. Yes they are expensive but I have never had a problem with them
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
K
Verified Purchase
Kathyzhere
New York, US
★★★★★ 5
As advertised
Size: 1 Count (Pack of 1), Style: Cartridge Ink
Works well in my Epson printer
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2026
G
Verified Purchase
GrizzDean
West Palm Beach, US
★★★★★ 5
Excellent, prompt, zero hassle protection
I purchased a nice 3D printer for my grandson. He was thrilled and he and his dad used it frequently. The printer developed a serious problem but, thankfully, I had also purchased a three-year protection plan with Asurion. We shipped the printer to Asurion via UPS since they readily agreed to repair it or refund the purchase price. After only a few days, Asurion emailed me that the printer was not repairable. They sent me a link that enabled me to send the full purchase price to my Amazon account. I used it to purchase another printer. I am happy and my grandson is thrilled! I should add that the extended protection did not cover sales tax, nor did it cover shipping cost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2026
A
Verified Purchase
Alexander
Natrona Heights, US
★★★★★ 5
Strongly recommend
I recently used the services of this company, and I was completely satisfied. They work very professionally: whenever I reached out, they quickly resolved any issues. I strongly recommend that anyone who purchases electronic devices register their product with this insurance. It is truly reliable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026

recommand products