Pay in installments of $75.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 31 - Sep 5
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
JAM-C His Tag Protein, MouseProduct Specification Species Mouse Antigen JAM C Synonyms CD323; JAM 2; JAM3; JAMC; JAM C; JAM CFLJ14529; junctional adhesion molecule 3JAM 3; junctional adhesion molecule C Accession Accession#: Q9D8B7 Amino Acid Sequence Glu30 Asn241, with C terminal 8*His
Product Specification
| Species | Mouse |
| Antigen | JAM-C |
| Synonyms | CD323; JAM-2; JAM3; JAMC; JAM-C; JAM-CFLJ14529; junctional adhesion molecule 3JAM-3; junctional adhesion molecule C |
| Accession | Accession#: Q9D8B7 |
| Amino Acid Sequence | Glu30-Asn241, with C-terminal 8*His EAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPVTPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYDLNGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 30-35kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1.Chavakis, T. et al. (2003) Thromb. Haemost. 89:13.2.Aurrand-Lions, M. et al. (2001) Blood 98:3699.3.Spermatid differentiation requires the assembly of a cell polarity complex downstream of junctional adhesion molecule-C.Gliki G., Ebnet K., Aurrand-Lions M., Imhof B.A., Adams R.H.4.Antibody against junctional adhesion molecule-C inhibits angiogenesis and tumor growth.Lamagna C., Hodivala-Dilke K.M., Imhof B.A., Aurrand-Lions M. |
Background
The family of junctional adhesion molecules (JAM), comprised of at least three members, are type I transmembrane receptors belonging to the immunoglobulin (Ig) superfamily. These proteins are localized in the tight junctions between endothelial cells or epithelial cells. Some family members are also found on blood leukocytes and platelets. Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM2 to regulate different cellular processes. Plays a role in homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow. At the surface of bone marrow stromal cells, it contributes to the retention of the hematopoietic stem and progenitor cells expressing JAM3. Plays a central role in leukocytes extravasation by facilitating transmigration through the endothelium. Plays a role in spermatogenesis where JAM2 and JAM3, which are respectively expressed by Sertoli and germ cells, mediate an interaction between both cell types and play an essential role in the anchorage of germ cells onto Sertoli cells and the assembly of cell polarity complexes during spermatid differentiation. Also functions as a counter-receptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy