Pay in installments of $59.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 31 - Sep 5
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
LTBR/TNFRSF3 His tag Protein, HumanProduct Specification Species Human Antigen LTBR TNFRSF3 Synonyms Lymphotoxin beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2 related protein Accession P36941 Amino Acid Sequence Gln31 Met227, with C terminal 8*His
Product Specification
| Species | Human |
| Antigen | LTBR/TNFRSF3 |
| Synonyms | Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein |
| Accession | P36941 |
| Amino Acid Sequence | Gln31-Met227, with C-terminal 8*His QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 27-36kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Piao W., Xiong Y., Li L., et al. Regulatory T cells condition lymphatic endothelia for enhanced transendothelial migration. Cell Reports. 2020;30(4):1052-1062.e5. |
Background
LTBR is a type 1 single transmembrane protein and member of the tumor necrosis factor receptor (TNFR) family that plays a critical role in the development of secondary lymphoid organs. The human LTBR gene is located on chromosome 12p13, in the same locus as two other members of the TNFR family—TNFR1 and CD27. The human LTBR gene shares 76% homology at the nucleic acid level with its mouse counterpart, located on chromosome 6. LTBR is widely expressed in blood and LECs, intestinal epithelial cells, dendritic cells (DCs), and lymph node (LN) stromal cells. The protein is conspicuously absent in T cells, B cells, and NK cells. LTBR binds strongly to two different natural ligands in homeostatic conditions, LTα1β2 and LIGHT (TNFSF14). LTBR signaling pathway plays an essential role in lymphatic organogenesis, tissue regeneration, organ development, tumorigenesis, and immune response to pathogen infection. Functionally, the absence of LTBR signaling leads to the retention of mature T cells in the thymic medulla.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy