Pay in installments of $52.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 31 - Sep 5
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CD83 Fc Chimera Protein, HumanProduct Specification Species Human Antigen CD83 Synonyms B cell activation protein, BL11, BL11CD83 antigen, CD83 antigen (activated B lymphocytes, immunoglobulin superfamily), CD83 molecule, Cell surface protein HB15, cell surface glycoprotein, HB15, HB15hCD83 Accession Q01151 Amino Acid Sequence Thr20 Glu144, with C terminal Human IgG Fc
Product Specification
| Species | Human |
| Antigen | CD83 |
| Synonyms | B-cell activation protein, BL11, BL11CD83 antigen, CD83 antigen (activated B lymphocytes, immunoglobulin superfamily), CD83 molecule, Cell surface protein HB15, cell-surface glycoprotein, HB15, HB15hCD83 |
| Accession | Q01151 |
| Amino Acid Sequence | Thr20-Glu144, with C-terminal Human IgG Fc TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 43-55kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Carenza C., Calcaterra F., Oriolo F., Di Vito C., Ubezio M., Della Porta M.G., Mavilio D., Della Bella S. Costimulatory Molecules and Immune Checkpoints Are Differentially Expressed on Different Subsets of Dendritic Cells. Front. Immunol. 2019;10:1325. 2. Tze L.E., Horikawa K., Domaschenz H., Howard D.R., Roots C.M., Rigby R.J., Way D.A., Ohmura-Hoshino M., Ishido S., Andoniou C.E., et al. CD83 increases MHC II and CD86 on dendritic cells by opposing IL-10-driven MARCH1-mediated ubiquitination and degradation. J. Exp. Med. 2011;208:149-165. 3. Peckert-Maier K., Royzman D., Langguth P., Marosan A., Strack A., Sadeghi Shermeh A., Steinkasserer A., Zinser E., Wild A.B. Tilting the Balance: Therapeutic Prospects of CD83 as a Checkpoint Molecule Controlling Resolution of Inflammation. Int. J. Mol. Sci. 2022;23:732. |
Background
CD83 is synthesized as a type I transmembrane glycoprotein that contains a 114 amino acid (aa) extracellular region, a 22 aa transmembrane segment, and a 39 aa cytoplasmic domain. Among costimulatory molecules, CD83 has the function of promoting the expression of other activation markers such as CD86 and the MHC class II. A variety of immune cells, including B cells, thymus-epithelial cells (TECs), T cells, DCs, and neutrophils, are known to express the CD83 molecule. CD83 is essential for the activation of T cells that regulate peripheral immune responses. CD83 is one of the markers of matDCs, as CD83 is highly expressed during DC maturation.The CD83 molecule has been identified to be expressed on many activated immune cells, including B and T lymphocytes, monocytes, dendritic cells, microglia, and neutrophils. CD83 is not a typical co-stimulatory molecule, but rather plays a key role in controlling and resolving immune responses. In addition, CD83 is an important factor in the differentiation of T and B lymphocytes and in the development and maintenance of tolerance.Two isotypes of CD83, a membrane-bound form and a soluble form.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy