SKU: 79024814873

IGFBP-7 His Tag Protein, Human

Sale price$315.00 Regular price$350.00
Save 10%

Pay in installments of $87.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IGFBP-7 His Tag Protein, HumanProduct Specification Species Human Synonyms IGFBP 7, IBP7, MAC25, PSF Accession Q16270 Amino Acid Sequence Asp30 Leu282, with N terminal 10*His HHHHHHHHHHGGGSGGGSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL Expression System HEK293 Molecular

Product Specification


Species Human
Synonyms IGFBP-7, IBP7, MAC25, PSF
Accession Q16270
Amino Acid Sequence

Asp30-Leu282, with N-terminal 10*His HHHHHHHHHHGGGSGGGSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Expression System HEK293
Molecular Weight

33-36kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Lin J. et al. (2007) Methylation patterns of IGFBP7 in colon cancer cell lines are associated with levels of gene expression. J Pathol. 212(1): 83-90.

Background

Insulin-like growth factor binding protein-7 (IGFBP7) is a member of the IGFBP family, which binds insulin with high affinity and IGF with low affinity. IGFBP7 was originally identified in normal mammary epithelial cells and meningeal cells, and its expression pattern varies with tumor type. In some tumors, IGFBP7 exhibits tumor suppressor activity in certain cancer types via regulation of cell proliferation, apoptosis, cell adhesion epithelial mesenchymal transition (EMT) and angiogenesis. However, IGFBP7 acts as a cancer-promoting gene in esophageal adenocarcinoma and neck squamous cell carcinomas. Together, IGFBP7 may provide potential value for the immunotherapy of cancer.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 79024814873

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Hanna
Grantham, US
★★★★★ 5
Still The Best Frother Ever!
Color: Black
I love how it is easy to use, how it holds a charge, and how much power it has. I've only charged it once since I got it & I've been using it on a daily basis!!! Though it isn't a long time, I'm happy with it so far! I definitely will recommend it to anyone looking for a great frother. If you are looking for one, look no further! You won't be disappointed! I've read some comments where they found it to be too strong that their drink spilled everywhere. But for me I have not had any incident of spilling over. I have used it both for my coffee and my matcha tea and it worked great without any spilling over. You just have to start with the lowest power and ensure that you have a large enough container to have a room for your frothing. My sister tried to use it recently during her visit to make us matcha tea. However, she experienced spillage all over the cup, because she had used a small cup. Otherwise, she liked it very much and said she will get one when her battery operated one stops working... Another thing I like about the product was the customer service that I had received. When I got my first order which came quickly, it wasn't working after having charged it over 24 hours. It was not turning on at all. I returned it and ordered a replacement which I received within a day or two. This time after charging it for the recommended amount of time, I was a bit skeptical when I turned it on. However, I was pleasantly surprised that it worked like it was supposed to and it has been working ever since having charged it only once so far. I may come back and give an update depending on how it does after 6 months of use, so keep in tune... I don't know if there is a way to write a new entry as a follow up to the old entry, so I'm going to add my follow up comment over here. May 23, 2025 - I love my frother more than I can say in words. It's functionality has not changed a bit from the time I have purchased it. It charge lasts several weeks to few months before I charge it again and the power is still the same. Recently I decided to buy another one for my office use. I like the white color and so tried it but that one wouldn't even turn on. And then I got a gray one to have a different color. That one was much weaker than the black one I own. Then I replaced it with another gray one within few days. I tried it and it was exactly the same as the one I already replaced. So then I decided to go with a black one again hoping that it would be the same as the one I have. The black one did much better than the gray ones in the strength or power of the frother. However, it is weaker than the one I already have been using since last August. While I am not very happy with the quality being inconsistent in all of the ones I have tried including the recent pictures of the black one, I have decided to keep the black one because it is relatively better than the gray ones I tried. What I don't understand is why there is inconsistency in the quality of the same product by the same maker. I am beginning to wonder if the black one I purchased in Augusta last year was anomaly of a quality and a good way. Maybe I lucked out on my older black frother, but I'm unsure if quality is going to get better if I were to order another one. I have a sister who is a pro in making coffee drinks and she was the reason I had ordered this frother to begin with. She uses a battery operated one at this time and I have been thinking about getting her one like mine. While I am still skeptical, I am going to give it a shot and order her one sometime soon. If it doesn't work, I guess we will return it back. But one thing that I am grateful is that I have been able to return every one of those that I have tried recently with no issues. I hope that I don't have to return my most recent purchase in black. I was not even able to review the new purchase because of the item being the same color which is crazy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 8, 2024
R
Verified Purchase
R. Cordosi
Massapequa, US
★★★★★ 5
Outstanding Frother!
Color: Space Gray
Exceptional! This frother is in another league compared to the cheapo push button frothers. The motor is smooth, quiet and powerful. This has an intuitive thumb dial on top that operates smoothly with a wide range of smooth speed adjustment. It’s gentle enough to froth a little bit of milk for a macchiato and powerful enough to scramble 3 eggs. The head is removable for easy cleaning. It’s also rechargeable. I charged this the day I bought it on April first. I use it at least twice a day. It’s September 26th today and I have yet to recharge it and it’s not showing any signs of needing a charge. One minor quibble is that they give you 2 of the same frother heads. They are built so well, that I don’t imagine it ever wearing out. It would have been nice to get a whisk or something different. Not a deal breaker at all though.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 26, 2025
B
Verified Purchase
banjo player
West Palm Beach, US
★★★★★ 5
Solid unit
Color: Black
Handheld Mixer/Frother Review A Premium Choice That Transforms Morning Coffee I am thoroughly impressed with this handheld mixer and frother. Each morning, I blend cacao and collagen powder into my coffee, and in the past, I always ended up with stubborn lumps using only a spoon or whisk. I had previously purchased a few inexpensive handheld mixers, but they disappointed me both in price and performance, struggling to mix the powders thoroughly—especially at the bottom of the cup. I came close to abandoning handheld mixers altogether, but decided to give it one last try. After reading countless reviews and carefully comparing models, I opted to invest in a higher-end handheld mixer. The anticipation was high—would this mixer truly distinguish itself from the budget options cluttering my kitchen drawer? From the moment I unboxed it, the difference was clear. The mixer felt substantial in my hand, and the build quality reflected thoughtful engineering. While this model cost roughly twice as much as the cheaper alternatives, it proved to be well worth the investment. Initially, I was concerned about the dial at the top, fearing it might be difficult to control. However, I was pleasantly surprised by its intuitive operation. The unit offers a solid feel, plenty of power, and a versatile range of speeds—from a gentle stir perfect for coffee to an impressively fast setting. I had not previously considered using this mixer as a frother, but as a cappuccino enthusiast, I decided to give it a try. I heated both 2% milk and oat milk to take the chill off, then submerged the mixing wand. Allowing the mixer to rise above the milk introduced air and created a rich, creamy foam—an unbelievable result. My homemade cappuccino now tastes like something from a café. The controls are robust, the construction is reliable, and the power is consistent. Cleanup is effortless, requiring only a quick rinse under the tap. The battery life is also noteworthy, lasting through several uses without losing strength. If you are hesitant to spend a bit more on a quality handheld mixer, I wholeheartedly recommend making the investment. This mixer has become an essential part of my morning routine. Excellent product—well done!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 13, 2025
P
Verified Purchase
Philip B. Corriveau
Birmingham, US
★★★★★ 5
Solid, powerful, rechargeable
Color: Black
Very impressed with its weight, speed and performance. The dial is great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
C
Verified Purchase
Chief
Belleville, US
★★★★★ 4
Very nearly the perfect frother for all your basic frothing & mixing needs
Color: Black
There are a lot of middle-of-the-road frothers out there. I've been through a few of them in my recent search for something that could mix and froth well, without taking up any more outlets in my basement kitchen. Of the three Maestri frothers I've tried so far, this one wins the race by a nose. Most recently, these Maestri frothers come in basically three versions: A single-speed @ 8000 RPM, a two-speed @8000/5500 RPM, and this stepless variable-speed version. Aside from that, the only real difference in recent version pack-outs is which attachments they come with. Look over the reviews of the single-speed version and you'll find that while it can and does froth well, it starts at a single, high speed and gets there fast. This makes it pretty easy to spin liquid right out of most common cups and mugs. There is a two-speed version, but it's harder to find, only comes in one color (Grape Purple), and while it's much better than the Maestri single-speed, it still has a couple of quirks that make this variable-speed version win out. This mixes and froths whole milk, half-and-half, or heavy whipping cream, or just about anything else very well. Like all frothers, it takes a little time to learn its nuances and nail down the technique, this will definitely get you there. The best feature of this is easily the speed control. Turn the knob to turn it on at a low speed that's great to get things started, then turn the knob to crank up the speed just enough to do what you need, whether that's mixing or frothing. The low starting speed makes it easy to keep things under control without undue spilling, and the max speed is more than enough to make quick work of getting your froth on. There are really only two complaints I have with this stepless, variable speed version: - I'd really like to have a Press On / Release Off button in addition to the Speed Control knob. More than one time have I gone to turn this off, only to spin the knob the wrong way and crank the speed up to ludicrous, sloshing liquid on the counter. Being able to turn it Off just by letting go of the button would be quick and easy. This configuration would allow using a preferred speed right from the start, while still allowing speed to be adjusted on-the-fly when needed. - Give it a bigger battery. It would cost mere pennies to give this a 2000mAH+ instead of a 1200mAH battery, and I can't think of any reasonable downside to that. - Give the motor a little more torque. It's fairly easy for the current motor, at any speed, to get bogged down in a thick protein powder mix, or when pressing the frother or other attachment a bit too hard into the bottom or side of the frothing container. A bit more "oomph" would prevent that. I really like the overall design and features of thes Maestri frothers better than many other, cheaper versions. This variable-speed version is pretty great as it is and probably the one I would recommend over the single- or two-speed, for most people. But I often find myself using two hands -- one to hold it steady, and the other to turn it on and tweak the knob to the desired speed(s) -- for a device that should arguably need only one hand to use. Just a couple of minor tweaks as noted above would make this the overall best frother of its type that I've used.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2025

recommand products