SKU: 49276010012

ALK-1/ACVRL1 Fc Chimera Protein, Mouse

Sale price$266.40 Regular price$296.00
Save 10%

Pay in installments of $74.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ALK-1/ACVRL1 Fc Chimera Protein, MouseProduct Specification Species Mouse Synonyms SKR3, ALK 1,TSR I Accession Q61288 Amino Acid Sequence Asp23 Pro119, with C terminal Human IgG1 Fc

Product Specification


Species Mouse
Synonyms SKR3, ALK-1,TSR-I
Accession Q61288
Amino Acid Sequence

Asp23-Pro119, with C-terminal Human IgG1 Fc DLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 45-50 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Cindy Lora Gil. Bruno Larrivée. Alk1 haploinsufficiency causes glomerular dysfunction and microalbuminuria in diabetic mice. Scientific RepoRtS (2020) 10.

Background

The Bone Morphogenetic Protein (BMP) receptor Activin receptor–like kinase 1 (Alk1), which is predominantly expressed in the vascular endothelium, has been shown to play a critical role in angiogenesis. Embryos lacking Alk1 die early during embryonic development due to impaired vascular remodeling and lack of perivascular cell coverage. In renal physiology, Alk1 has been suggested to play an important role in the regulation of extracellular matrix deposition, including collagen type I and fibronectin, and Alk1 heterozygosity has been associated with increased renal fibrosis in a mouse model of obstructive nephropathy, probably due to the decrease in the Alk1/Smad1 antifibrotic/protective signaling in renal fibroblasts.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 49276010012

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
SH
Belleville, US
★★★★★ 5
Great power strip for my shop vac and miter saw!
Size: 12 Outlet
Works great in my garage! I currently have it mounted on the wall and have my shop vac and miter saw plugged in. It makes it incredibly easy to turn the master switch on and have my shop vac and miter saw turn on at the same time. When I’m not using the shop vac and miter saw combo, I shut off their individual switches and I’m free to use the other plugs so the individual switches for each outlet are very handy! It’s very durable as I have it mounted on the wall and has an adequate number of outlets for my work bench. The size is just right and it was very easy to mount. My only suggestion is to space the screw holes on the power strip so that it can be mounted between 2 standard wall studs 16 inches on center for unfinished wall mounting. The screw holes didn’t line up like this so I could only put screws on one side of it and I needed to improvise a way to secure the other side of the power strip to the next stud so it was as mounted securely and didn’t move as I plugged and unplugged things.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 14, 2025
M
Verified Purchase
Milton Lee
West Palm Beach, US
★★★★★ 5
Perfect power strip
Size: 6 Outlet
Great value for the money. I love the switches for each plug and has lights at each plug; lets you know when you have a outlet switched on, love that. Well-made, heavy-duty cord and circuit breaker, all high quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
A
Verified Purchase
Arthur Liegeois
New York, US
★★★★★ 5
3300 Joules surge protected, sturdy and perfect for my office
Size: 12 Outlet
I purchased this power strip once a few months ago, and just purchased a second one, both for my office! I use the first one screwed at the bottom of my desk to plug in my Mac, 2 monitors, 2 Homepod, 1 external drive, my Echo Dot and a few other things. What I love about this is: 1. It has 12 slots that are perfectly spread out so that all of the power plugs, even the bulkier ones, fit nicely next to each other 2. There is a killer switch on each slot, which makes it globally safer if one of the outlet fries, or if I want to turn off some of the devices while I am away. It also includes a 3300 Joules surge protection, which is quite high comparer to similar power strips! Luckily, I never had to test its efficiency yet... I am pretty sure it won't replace a proper but much pricier UPS device, but it's better than nothing! 3. I love the fact that you can contain all of the wires on the sides, so that they don't dangle and don't get tangled. 4. This is very well built, it feels sturdy. I don't especially like the yellow color, but to be honest, it's hidden anyway! So I just purchased another one to plug in all of the devices that I have on the other side of my office: the eero modem, echo amp, Mac Mini, Nas Drive, printer and the Philips Hue hub and lights, and it all works like a charm, and doesn't catch dust as much as before. Most of the time, I'm very critical about what I purchase, but in this case, I think it's great and worth sharing ;-)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 26, 2024
G
Verified Purchase
Gene
Massapequa, US
★★★★★ 5
Works great! Buying more.
Size: 10 Outlet
Works great! Love the feature that allows you the ability to turn individual plugs off and on. The ability to run the chords through both ends for a clean look is a nice feature too. In the process of buying two more for the bedrooms.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2026
B
Verified Purchase
Brian
Whiting, US
★★★★★ 5
Versatile, High-Quality Power Strip for Home Use
Size: 6 Outlet
Nice, Heavy-Duty Power Strip that can be used in many ways. I installed two of these strips in my garage and am pleased with the results. The individual switches for each plug is a plus if you need that amount of control. The strip mounted easily. The materials and quality appear to be excellent, telling me that the power strip will last many years.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2026

recommand products