SKU: 66234241017

Human PRDM1/Blimp1 Protein, His tag

Sale price$195.75 Regular price$217.50
Save 10%

Pay in installments of $54.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PRDM1/Blimp1 Protein, His tagProduct Specification Species Human Synonyms PR domain zinc finger protein 1, BLIMP 1, Beta interferon gene positive regulatory domain I binding factor, PR domain containing protein 1, Positive regulatory domain I binding factor 1 (PRDI BF1; PRDI binding factor 1), BLIMP1 Accession O75626 Amino Acid Sequence Protein sequence (O75626, Lys38 Gln223, with C His tag)

Product Specification


Species Human
Synonyms PR domain zinc finger protein 1, BLIMP-1, Beta-interferon gene positive regulatory domain I-binding factor, PR domain-containing protein 1, Positive regulatory domain I-binding factor 1 (PRDI-BF1; PRDI-binding factor 1), BLIMP1
Accession O75626
Amino Acid Sequence

Protein sequence (O75626, Lys38-Gln223, with C-His tag) KMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQ

Expression System E.coli
Molecular Weight Predicted MW: 23.5 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Liquid
Storage Buffer

Supplied as a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 5% glycerol.

Stability & Storage

12 months from date of receipt, -20℃ as supplied.

Background

PRDM1 (PR domain zinc finger protein 1) is a transcription factor critical for cell fate determination and terminal differentiation. It plays a pivotal role in B cell development, driving mature B cells into antibody-secreting plasma cells while repressing B cell identity genes. Beyond immunity, PRDM1 regulates differentiation in other lineages, such as T cells and epithelial cells, and acts as a tumor suppressor in multiple cancers by inhibiting cell proliferation and inducing apoptosis. Dysregulation of PRDM1 is linked to lymphoid malignancies (e.g., multiple myeloma, diffuse large B-cell lymphoma) and solid tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66234241017

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Rajeshwari Kute
Draper, US
★★★★★ 5
Great lighting solution for bookshelves
Color: 3000K Warm, Size: 2Roll x 16.4ft, Color: 3000K Warm, Size: 2Roll x 16.4ft
This turned out to be the best solution for lighting up my bookshelves. I like the quality of the product and the brightness of the lights.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
J
Verified Purchase
J. Lin
Lexington, US
★★★★★ 5
Polarity
Color: 6500K White, Size: 1Roll x 16.4ft, Color: 6500K White, Size: 1Roll x 16.4ft
I've been looking into various kits and components but this one seemed to fit my needs perfectly - all components included and the flexibility to cut strips (up to 6) to the lengths I needed. Its also very thin and needs no other mounting hardware, channels, diffusers, screws, etc. No instructions - but everything only fits together one way except which end of the LED strip to connect to (polarity). For my reel, it was towards the center of the reel and not the freed end - which meant I had to cut a piece off and connect the end that was just cut. Insert the cut end into the connect after peeling off a bit of the blue tape. You can also peel off a little bit of the white tape beneath that to expose the copper contacts - but the connector contacts can pierce that layer if you don't want to peel off the white layer also. (Don't peel it all off, just enough to to fit into the connector.) Insert the end, press down the hinged part until it clicks or is otherwise all the way clamped - don't need tools, just your fingers squeezing it is enough. Test the assembly by plugging it into the power supply. You can also connect the remote - a blue LED on the power supply tells you whether its on or off. Once I figured out which end to connect to, everything was quite straightforward. I installed my 6 strips in my small pantry - one for each shelf - and routed all the wires to one side, mostly hidden. I mounted the remote on the pantry door - it can sense through the door - which is not very thick - as well as just tapping it once the door is open. The remote can be touchless - just wave your hand near it - but it seems to also sense tapping from some objects. Holding down on the remote activates dimming - it will cycle through brightness and stop when you release. Other than that, its as simple as I had hoped and took me about an hour to install (I expect my next install will be 30 mins). I am planning to order more kits for other closets, kitchen, etc.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 29, 2024
A
Verified Purchase
Andrew B.
Waukegan, US
★★★★★ 5
UPDATED: Replacement works great
Color: 3000K Warm, Size: 1Roll x 16.4ft
FINAL UPDATE: Seller shipped new power unit and it works great now. The lights are really great and super easy to cut to size and use. UPDATE 1: Seller got in touch and is sending replacement power unit. Will update again once it arrives. I do really like the look of these and they did wonders for a dark park of my closet that has built-ins. ORIGINAL: Lights stopped working after about 6 weeks (beyond the 30 day return policy). Seems like the control unit died. Haven’t found any feasible way to contact seller or manufacturer. Will update review if anything changes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2025
A
Verified Purchase
Aerdnua24
Boise, US
★★★★★ 4
Light it up!
Color: 3000K Warm, Size: 2Roll x 16.4ft, Color: 3000K Warm, Size: 2Roll x 16.4ft
I am very happy with these. They are easy to use. The only reason I am not giving a five star review is because the instructions and assembly weren’t the easiest. At first we could not get them to work. After looking through the reviews, one man told us that the -\+ were backwards and we tried what he suggested and they worked. I do suggest that because there are two light reels there should be two connecter boxes as well. We had to purchase two packages. Overall, We are satisfied with our purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
C
Verified Purchase
Chris
Battle Creek, US
★★★★★ 1
Quality just isn’t there
Color: 3000K Warm, Size: 2Roll x 16.4ft
Was very excited to receive this product because I had difficulty lighting op these LED strip lights, this looks like a package that had everything that I needed. First off, the strip lights themselves are very thin with wise and would look funny on my project, the adhesive backing did not stick at all once removed The touch sensor works great for about 10 minutes and then completely died, overall not impressed with the quality of this product, sending back
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 4, 2026

recommand products