SKU: 3328546676

Rat Alpha-1-acid Glycoprotein Protein, His tag

Sale price$209.25 Regular price$232.50
Save 10%

Pay in installments of $58.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat Alpha-1-acid Glycoprotein Protein, His tagProduct Specification Species Rat Synonyms Orosomucoid (OMD), Orm1 Accession P02764 Amino Acid Sequence Protein sequence (P02764, Gln19 Pro205, with C His tag) QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP Expression System HEK293 Molecular Weight Predicted MW: 23. 3 kDa Observed MW: 23 43 kDa Purity 95% by SDS

Product Specification


Species Rat
Synonyms Orosomucoid (OMD), Orm1
Accession P02764
Amino Acid Sequence

Protein sequence (P02764, Gln19-Pro205, with C-His tag) QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP

Expression System HEK293
Molecular Weight Predicted MW: 23.3 kDa Observed MW: 23-43 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Alpha-1-acid glycoprotein, also known as orosomucoid, is a major acute-phase protein synthesized primarily in the liver. As a glycoprotein with high carbohydrate content, it exhibits increased plasma levels during inflammation, infection, or tissue injury, reflecting its role in immune modulation and host defense. Structurally, AGP binds to various ligands, including drugs, lipids, and cytokines, influencing drug pharmacokinetics and immune cell interactions. It is involved in regulating inflammation, modulating lymphocyte function, and potentially contributing to tumor progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3328546676

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
O
Verified Purchase
Oldvtgal
Los Angeles, US
★★★★★ 5
For soft, sensually awesome sheets- LOOK no more!
Color: 15 - Sage Green, Size: Full
Would give 10 stars if possible! (And this is a nonpaid for review!) When I received the sheets, instantly I knew that I had the right ones, had bought a down comforter close in color as well.. these sheets? The material is strong yet, soft and warm. So so especially soft, and when I make up the bed, ahhh! plus the corners on the fitted, such a cinch to pull over the mattress, even with a topper on the bed! Feels almost spa-like <3 Very comfy, so far in the winter and in 85 degree heat! Soft and easy peasy to care for, too. Washing is a breeze, dry and fold. So far the only thing I can smell on these sheets is my wonderful detergent! Will purchase again. And possibly, again! Thank you!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
K
Verified Purchase
Kari
Pawtucket, US
★★★★★ 5
Fit ✅ Color ✅ Soft ✅
Color: 09 - Brown, Size: King, Color: 09 - Brown, Size: King
Color is exactly as advertised. Feels very soft, fits perfectly. No weird odor and not too warm 🥵. Only downfall I can tell is it seems a bit thin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
M
Verified Purchase
michele schmitz
Louisville, US
★★★★★ 3
Very thin. You get what you pay for.
Color: 01 - White, Size: Queen
You get what you pay for. I first noticed the softness which was great. The quality is very thin. They are cool which is great. I have not washed them yet. I would suggest washing them on cool and gentle by themselves. And because they are so thin I would fluff dry for an hour if you have that setting. The two things that damages clothes and sheets, etc. are if you have an agitator in your washer, those ruin clothes and the heat you choose for the fabric you’re drying I always wash my clothes on cold. I do not have an agitator anymore and on delicate and thin fabrics, I use fluff dry. It is cool, but it will dry, especially if it is thin and I’ve had to dry my fine delicates a little bit longer on fluff that way they don’t shrink because the shrinking comes in from the heat from the dryer so keep that in mind another good thing to remember if you got white sheets like I did is that when you use your detergent add a little bit of borax or laundry booster and they will help get them clean and sparkly white. I am on the fence about whether I would recommend this or not if you’re tight on money and you take good care of them I would recommend that you get them. I’m a linen freak and I buy mostly expensive sheets and I thought I would try this out so that’s where I’m at.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
J
Verified Purchase
John cromwell
Natrona Heights, US
★★★★★ 5
Finally we BOTH can sleep comfy!
Color: 08 - Black, Size: Queen
So for years my boyfriend has always liked “jersey sheets” or “tee shirt” sheets or sheets made of flannel. He says he doesn’t like the feeling of cold “silky” feeling sheets as he’s always cold. I’m opposite and am always hot, and anytime we stayed in a nice hotel I looked forward to being able to sleep on cooler, taught, soft sheets for a couple of nights. I was able to deal with our old sheets but the issue we both hated was after awhile any sheet we got would get pilling. We even splurged and got a $60 flannel sheet which did the same thing forcing me to shave off these little annoying fuzz balls that make it feels like there is thousands of crumbs on the sheets. I also would wash our bedding once a week because the Jersey sheets seemed to “grow” as we move around in bed making it so the sheet was not taught and super annoying to lay on. The day I would wash them they would be comfortable but ultimately by the end of the week they would be almost hanging off our mattress. I ordered these sheets on a whim and got them the same day and immediately just threw out the jersey sheet and put this on (I didn’t even wash it, I know it’s gross but I was desperate for a comfy nights sleep and they came around 8pm) when I put them on I realized how soft and comfortable they felt. I also liked how the pillow cases are larger than most pillow cases that I have had in the past. We’ve been using these sheets for about a week and I love how I don’t wake up with my pillow popping out of the case anymore. The sheets have loosed ever so slightly since a week of sleeping but still are really taught and comfortable. They are cooler than flannel or fabric sheets and are initially cold when you first lay on them but I wouldn’t consider them “cooling” but they keep me from feeing extremely hot. They are way better than I ever would have expected for the price. I look forward to laying on them at the end of each day, even my boyfriend laid in bed the day I got them and said “wow I didn’t think I would like sheets like this, these are so soft!” And fell asleep immediately. We ended up ordering a second set in grey and the color is pretty. I still have yet to wash them, I usually use 2 tide pods when washing the bedding but I might get some fabric softener (as I hear it helps with pilling) to prevent the possibility of having that happen to these sheets in the future. I am hoping they hold up well after the wash and longer use. If they start to pill after wash, I will come back and update my review. Until then, I would highly recommend these sheets for the quality and the price point that they are offered at. Honestly, at this point even if they pill months from now I probably wouldn’t even be upset as long as they stay the same price I would just buy another set as they are just that comfortable and soft. UPDATE: So it has been about 3 months since I have purchase and used these sheets. They are still as soft as the day I first put them on. I’ve been washing them bi-weekly along with my comforter and pillowcases. I wash them with warm water using a combination of tide pods and added Downy fabric softener. They say to hang dry them in the description but I have been putting them in the dryer on medium and have been taking them out after around 20-25 minutes, they seem to dry extremely quickly. They have yet to have absolutely any pilling and also have not shrunk or stretched. Also I have a cat that is very active and also sleeps with me who enjoys kneading on my bed and I haven’t even noticed any signs of wear what so ever to the eye or to the feel. I highly recommend these sheets. I still have yet to even open the second set I purchased!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2024
J
Verified Purchase
Joy Joy
Draper, US
★★★★★ 5
Happy With Our Purchase
Color: 07 - Charcoal, Size: King, Color: 07 - Charcoal, Size: King
When we opened the package the sheets were soft. We wash everything before we use it, so in these went. The sheets held nicely through the washing machine, the edges stayed sewn up and the sheets are still fluffy. The sheets fit nicely on our bed and have a nice cooling effect in this 80-degree weather. We think these sheets were a quality purchase that was affordable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026

recommand products