Pay in installments of $44.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 1 - Sep 6
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
KMT5A His Tag Protein, HumanProduct Specification Species Human Antigen KMT5A Synonyms kmt5a,setd8N lysine methyltransferase KMT5A, Histone lysine N methyltransferase KMT5A, Lysine specific methylase 5A,SET domain containing protein 8 Accession Q9NQR1 2 Amino Acid Sequence Lys195 His352 HHHHHHHHKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH Expression System E. coli
Product Specification
| Species | Human |
| Antigen | KMT5A |
| Synonyms | kmt5a,setd8N-lysine methyltransferase KMT5A, Histone-lysine N-methyltransferase KMT5A, Lysine-specific methylase 5A,SET domain-containing protein 8 |
| Accession | Q9NQR1-2 |
| Amino Acid Sequence | Lys195-His352 HHHHHHHHKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH |
| Expression System | E.coli |
| Molecular Weight | 19.1kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris,300mM NaCl, pH8.0. |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles. |
| Reference | 1.Nishioka K, et al.(2002) PR-Set7 is a nucleosome-specific methyltransferase that modifies lysine 20 of histone H4 and is associated with silent chromatin.Mol Cell.Jun;9(6):1201-13. |
Background
KMT5A (SETD8/Pr-SET7/KMT5A) is an important member of the methyltransferase family. It is a specific single methyltransferase of histone lysine H4K20 and participates in a variety of biological processes such as transcriptional regulation, cell cycle regulation, DNA damage. Protein-lysine N-methyltransferase that monomethylates both histones and non-histone proteins. Especially monomethylates 'Lys-20' of histone H4 (H4K20me1). H4K20me1 is enriched during mitosis and represents a specific tag for epigenetic transcriptional inhibition. It mainly plays a role in the euchromatin region, thus playing a central role in the euchromatic gene silencing.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy