Pay in installments of $63.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 23 - Jul 28
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CD7 Ligand/SECTM1 His Tag Protein, MouseProduct Specification Species Mouse Antigen CD7 Ligand Synonyms CD7 Ligand, SECTM1, K12 Accession NP_663348 Amino Acid Sequence Gln28 Thr165, with C terminal 8*His QNKSWDNPICTEGILSVPRGNPAVMTCNISNTFTDVTIQLSANGKDKTIFDKKPQGNFSWRGWELQVQGGLAQLVIKDTQDDHTGIYLWQLHGRQRCYKNITLNILEPSNEDKVPDTTLFTSFPDHAKSSPIEGKPGTGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 35kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical
Product Specification
| Species | Mouse |
| Antigen | CD7 Ligand |
| Synonyms | CD7 Ligand, SECTM1, K12 |
| Accession | NP_663348 |
| Amino Acid Sequence | Gln28-Thr165, with C-terminal 8*His QNKSWDNPICTEGILSVPRGNPAVMTCNISNTFTDVTIQLSANGKDKTIFDKKPQGNFSWRGWELQVQGGLAQLVIKDTQDDHTGIYLWQLHGRQRCYKNITLNILEPSNEDKVPDTTLFTSFPDHAKSSPIEGKPGTGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 25-35kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Lyman S D. et al. (2000) Identification of CD7 as a cognate of the human K12 (SECTM1) protein. J Biol Chem. 275(5): 3431-3437. 2、Lam G K. et al. (2005) Expression of the CD7 ligand K-12 in human thymic epithelial cells: regulation by IFN-gamma. J Clin Immunol. 25(1): 41-49. |
Background
SECTM1 (secreted and transmembrane 1), also called K12, is either found as an approximately 27 kDa intracellular type I transmembrane protein that shows a perinuclear, Golgi‑like staining pattern, or as a 20 kDa soluble, secreted form. SECTM1 is expressed on thymic epithelial and fibroblast cells, breast cancer and leukemia cell lines, and neutrophils but not in peripheral lymphocytes. SECTM1 is expressed on cytomembrane, which is identified as a CD7 ligand.CD7 is expressed in T and natural killer (NK) cells, which could be activated by its ligand SECTM1, thus promoting the proliferation of T and NK cells. SECTM1 strongly costimulates CD4 and CD8 T cell proliferation and induces IFN-γ production, likely via a CD7-dependent mechanism. In addition, SECTM1 synergizes with suboptimal anti-CD28 to strongly augment T cell functions. A robust induction of IL-2 production when SECTM1 and anti-CD28 signals were present with TCR ligation.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy