Pay in installments of $90.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 22 - Jul 27
For Your Every Summer RSVP, with Code: SUMMER15
Description
PCSK9 His Tag Protein, RatProduct Specification Species Rat Synonyms PCSK9, FH3, PC9, FHCL3 Accession P59996 Amino Acid Sequence Gln31 Gln691, with C terminal 10*His
Product Specification
| Species | Rat |
| Synonyms | PCSK9, FH3, PC9, FHCL3 |
| Accession | P59996 |
| Amino Acid Sequence | Gln31-Gln691, with C-terminal 10*His QDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVVLMEETQRLQVEQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSLVFAQSIPWNLERIIPAWQQTEEDSSPDGSSQVEVYLLDTSIQSGHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRLILFSTKDVINMAWFPEDQRVLTPNRVATLPPSTQETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKALNAFGGEGVYAVARCCLLPRVNCSIHNTPAARAGPQTPVHCHQKDHVLTGCSFHWEVENLRAQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGIAGPAEQVTVACEAGWTLTGCNVLPGASLPLGAYSVDNVCVARIRDAGRADRTSEEATVAAAICCRSRPSAKASWVHQGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-70kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Jaén R I. et al. (2022) Functional Crosstalk between PCSK9 Internalization and Pro-Inflammatory Activation in Human Macrophages: Role of Reactive Oxygen Species Release. Int J Mol Sci. 23(16): 9114. |
Background
PCSK9 (proprotein convertase subtilisin-kexin type 9) is a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. PCSK9 undergoes an autocatalytic processing event with its prosegment in the ER and is constitutively secreted as an inactive protease into the extracellular matrix and trans-Golgi network. It is expressed in liver, intestine and kidney tissues and escorts specific receptors for lysosomal degradation. It plays a role in cholesterol and fatty acid metabolism. Atherosclerosis is a cardiovascular disease caused mainly by dyslipidemia and is characterized by the formation of an atheroma plaque and chronic inflammation. Proprotein convertase subtilisin/kexin type 9 (PCSK9) is a protease that induces the degradation of the LDL receptor (LDLR), which contributes to increased levels of LDL cholesterol and the progress of atherosclerosis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 5 reviews
Sort
Product Reviews
★★★★★ 5
Versatile with all the ports you’re looking for.
Compact and really expands your options. I was using one of the ports on the MacBook Pro M1 for a second display and the other for an external drive and then switching back and forth with the charger. This device does all that and only uses one of the ports. Plus there are multiple USB OLD STYLE still available. No external power appears to be necessary, although since I use the Mac power supply in the dedicated power in port I’d think there’d be no issue.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
★★★★★ 1
Good product, I suspect, if it works. (Also Marketing Needs Improvement)
UPDATE:
Nope, it's just the hub. :(
It's either defective or not a good product, which is unfortunate.
The stutter issue has been resolved, but I can still not use the dock to push an image to my secondary monitor (1080p).
I spent several hours this evening updating drivers for my Lenovo Thinkpad E15 Gen2 (AMD) without success. FYI: This laptop DOES support PD+DP through USB-C, something I confirmed before trying to go down the USB-C route in an attempt to replace my ancient Diamond USB-A dock.
An image was never sent to my second monitor, whether connected via HDMI or DP through the hub.
In all cases, the monitor IS recognized by Windows, so some information is being communicated, just not an image to the monitor.
During every attempt, when the monitor was first plugged in, responsiveness in Windows would stutter, lag, and generally respond slowly to my KB+M inputs until, eventually, the laptop caught up and was OK.
I am highly disappointed and am considering returning both products, but the USB-C dock is definitely returning.
It would be nice, but I don't need a 100W charger.
My hope of replacing my current USB-A dock is diminishing at the price point I was hoping for, so we shall see if it's up to the task of the new 2K monitor I have on the way and go from there.
Original:
Buyer be cautioned:
The Anker 565 USB-C also needs power for itself, which is evident if you think about it, but it's not stated anywhere that I could find, and it may not dawn on you until things aren't working quite right.
Lack of power could cause many issues I've read about in reviews.
The issue:
Mouse movement would stutter every 5-10 seconds.
Though Windows recognized my HDMI monitor in Device Manager/Display settings, no image was sent to it through the Anker hub.
Current theory:
So, the manufacturer's 65W USB-C charger for my laptop cannot FULLY power the hub with one connected HDMI monitor, two USBs, and Ethernet through the USB-C hub.
I did not test the two USB devices (Keyboard and headset) as there was little need once the stuttering began, which was immediate.
I have an Anker Nano 100W arriving tomorrow, and I will update the review once I've re-tested.
Suggestion:
My ask to Anker would be to *estimate* the power draw of their dock and list it somewhere with many warnings, etc.
If they wanted to go above and beyond and add averages for peripherals and the like, that would be amazing, but if not, I would understand, as I'm sure that information could become dated fast.
A power warning would have prompted me to consider the power charging situation, and I may gone with one of their docks (About a $100 increase) instead. But now that I'm annoyed, I'll purchase a 100W charger that I can use for my work laptop and elsewhere as needed. :)
They are still getting my money, but not as much.
They make amazing products, but small details like this matter to me as a consumer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 26, 2024
★★★★★ 5
Anker 11 in 1 Docking station as a Starter.
This is an entry level addition to a PC. If more ports needed then the 14 in 1 or a powered Hub.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
★★★★★ 5
Works as intended
I've been into emulators lately and this is a great HDMI out with charging capabilities to go with your high speed charging brick. Doesn't work for everything, but I can attest it works with the AYN Thor and a Google Pixel 8 Pro, and presumably higher end Pixels. Both have emulators and both come thru my TV just fine. Also works with Kodi. I tried to use wired controllers, but quickly figured I'm better off going Bluetooth on that route. I haven't tried file transfer or anything because all that mattered to me was getting it to the big screen. I'd rather have a docking stand for my needs, but freedom and flexibility isn't a bad thing for this device at a decent price and cheaper than a dock.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
★★★★★ 5
Versatile hub adds the ports my Mac lacks
This 7-in-1 USB C hub from Anker has made it easy to connect my laptop to all the devices I need. The HDMI port consistently outputs 4K video at 60Hz, while the USB 3.0 ports and SD/microSD slots transfer files quickly without errors. I appreciate that the pass-through charging allows me to power my MacBook while using the hub, and the unit itself feels solid and well made. It's truly plug-and-play, with no drivers to install, and it greatly expands the limited port selection on modern laptops. The only minor drawback is that the hub can get a little warm under heavy use, but overall it's a reliable, convenient accessory that I feel confident recommending.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026