SKU: 93875154365

SerpinF1/PEDF His Tag Protein, Human

Sale price$234.00 Regular price$260.00
Save 10%

Pay in installments of $65.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SerpinF1/PEDF His Tag Protein, HumanProduct Specification Species Human Antigen SerpinF1 PEDF Synonyms SERPINF1,Serpin F1,PEDF,PIG35,EPC 1 Accession P36955 Amino Acid Sequence Gln20 Pro418, with C terminal 8*His

Product Specification


Species Human
Antigen SerpinF1/PEDF
Synonyms SERPINF1,Serpin F1,PEDF,PIG35,EPC-1
Accession P36955
Amino Acid Sequence

Gln20-Pro418, with C-terminal 8*His

QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGPGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 47-53kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Published online 2022 Feb 15. doi: 10.1016/j.pep.2022.106072.

Background

Human SERPINF1 gene codes for pigment epithelium-derived factor, a secreted glycoprotein and member of the SERPIN superfamily. Pigment epithelium-derived factor, also known as PEDF, Serpin F1, and SERPINF1, is a multiple functional protein that has both anti-angiogenic activity and neurotrophic activity at the same time.PEDF has affinity for PEDF-receptor (PEDF-R), a membrane-linked lipase encoded by the PNPLA2 gene.PEDF is also responsible for apoptosis of endothelial cells either through the p38 MAPK pathway or through the FAS/FASL pathway.PEDF has a variety of functions including antiangiogenic, antitumorigenic, and neurotrophic properties.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 93875154365

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Agatha Marie
Los Angeles, US
★★★★★ 5
The shirts run true to size and are very well made.
Color: Wine Red-polka Dots, Size: 3X-Large
I want the company COOFANDY and the customers who are considering buying these men's wrinkle free men's shirts for casual business wear, to know that the shirts are beautiful. The material is perfect, and they are made exceptionally well! One of the two shirts that I bought for my husband looks great on him. I had to buy one in a size 2x and one in a size 3x due to the reviews on Amazon's website, where so many of the reviewers stated that the size that they bought ran too small, while other reviewers said the shirt runs too large. My husband tried on the 2x, and it fit him perfectly, which was great because he always wears a 2x. The reason that I am returning them both is that these shirts are tuck-in shirts, and my husband only wears shirts that do not have to be tucked in, such as straight-bottom shirts. I showed him the picture of the shirt in the ad to prove that the models wore them out, not tucked in, but he said the style is wrong for wearing this shirt on the outside, and that he would not be able to wear it. I am so sorry, but I had to return them as he would not ever wear them. But I wanted you, COOFANDY, and your customers to know that the shirts are well worth the money and are just beautiful!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
M
Verified Purchase
Missy Davis England
Waukegan, US
★★★★★ 5
Perfect fit for my husband
Color: Army Green, Size: Large
Very thick but it's cool, comfortable, no shrinking when washed and no fading. Love this color and the quality of material for the price is top of the line. I will be ordering other colors. My husband really enjoys wearing this and it fits perfectly. Thank you for the excellent work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
B
Verified Purchase
B House
Cuba, US
★★★★★ 4
Stylish, Well-Made Shirt—Just Might Need a Touch of Ironing
Color: Black-square, Size: 3X-Large
Why did you pick this product vs others?: My husband is a big fan of this shirt brand—they offer a great selection of styles, patterns, and fabrics, and the availability of a 3XL is a major win since it’s not easy to find that size. This particular shirt has a classy, lightweight feel with a subtle checkerboard texture that adds visual interest under the light. The fit is modern and breathable, perfect for summer wear. After washing it straight out of the package, the wrinkles from shipping didn’t fall out, so I wouldn’t call it truly wrinkle-resistant just yet. I’m hopeful that a single pass with the iron will help set it right. Overall, the shirt looks fantastic and the quality is impressive, especially for the price. Whether for a casual day or dressed up for an event, it’s a versatile choice—just be prepared to give it a little extra TLC after washing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 5, 2025
L
Verified Purchase
L. Anderson
Grantham, US
★★★★★ 5
Excellent value for your money
Color: Navy Blue-square, Size: X-Large
Comfortable with a slight stretch to the material. Wrinkles were minimal to nearly none after a day of wear. Material is soft with a nice feel to it. Overall great quality and would definitely recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
J
Verified Purchase
J.J.
Lexington, US
★★★★★ 5
Looks great and no need to iron
Color: Light Blue-square, Size: Large
The wrinkle-free dress shirts from COOFANDY are an easy addition to my wardrobe. They are affordable and look nice with colors that pop and a comfortable fit. Plus, I never have to iron!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026

recommand products