SKU: 37070328439

ACVR2B His Tag Protein, Mouse

Sale price$216.00 Regular price$240.00
Save 10%

Pay in installments of $60.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ACVR2B His Tag Protein, MouseProduct Specification Species Mouse Synonyms ACVR2B, ACTRIIB, HTX4, Activin receptor type IIB, Activin A Receptor Type 2B Accession P27040 Amino Acid Sequence Ser19 Thr134, with C terminal 8*His SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 35kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag

Product Specification


Species Mouse
Synonyms ACVR2B, ACTRIIB, HTX4, Activin receptor type IIB, Activin A Receptor Type 2B
Accession P27040
Amino Acid Sequence

Ser19-Thr134, with C-terminal 8*His SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

25-35kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Olsen O E. et al. (2020) Activins as Dual Specificity TGF-β Family Molecules: SMAD-Activation via Activin- and BMP-Type 1 Receptors. Biomolecules. 10(4): 519.

Background

Activin proteins that belong to the transforming growth factor-beta (TGF-β) superfamily, exert their biological actions by binding to heteromeric receptor complexes of type I and type II serine/threonine kinase receptors. On ligand binding, type I and II receptors form a stable complex, resulting in phosphorylation of type I receptors by type II receptors with constitutive kinase activity, and subsequently initiates the activation of downstream molecules including the endogenous Smads. ActRIIB, also known as ActRIIB, is a type II receptor containing an extracellular domain (ECD), a transmembrane segment, and a cytoplasmic region that includes the kinase domain. ActRIIB is a receptor for activin A, activin B and inhibin A. Multiple ActRIIB isoforms can also be generated, which bind activin isoforms with different affinities.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 37070328439

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jesse Lange
Fort Morgan, US
★★★★★ 1
Updated review: spitting and splintering
UPDATE: Originally, one of the boards arrived with a split in it, but I was still happy with them. After a few weeks of light use, hand washing and drying of the boards, I figured it was time to update this review and knock these down to 1 star. The boards do not hold up very well. Cut marks are deep, and they are starting to splinter. Another of the boards has also developed a split. Save your money and go with cutting boards from someone else. ORIGINAL REVIEW: I bought these cutting boards to cut down on microplastic exposure. This would be a 5 star review except that one of the boards arrived cracked (noticed while hand washing all of them before use). Despite the one cracked board, I did not return them, as I immediately started using the boards, was too busy to deal with it at the time, and the overall value was still there. These boards are great, the value is excellent since you get several of different sizes. I like that all sizes have the moat for juices, because sometimes you are cutting one or two chicken breasts or one steak and don’t want to have to grab a big board. I honestly am writing this review because I wouldn’t be surprised if the company sends me a replacement. If they do, I will update the review to reflect their customer service.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2025
B
Verified Purchase
Brittany Collins
Whiting, US
★★★★★ 5
Will buy again
Love my cutting boards. Great quality
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
J
Verified Purchase
Johanna M. Stephenson
Port Orchard, US
★★★★★ 5
Very Well Made
The Hiware Bamboo Heavy Duty Chopping/Cutting Boards Set is a popular kitchen accessory that offers a practical and eco-friendly solution for chopping, cutting, and slicing various ingredients. Here is a review of the product: 1. Design and Construction: The set includes four extra-large cutting boards made from high-quality bamboo, which is known for its durability and natural resistance to water and bacteria. The boards are pre-oiled, which helps to enhance their lifespan and maintains their appearance. The thickness and sturdy construction make them suitable for heavy-duty use in both residential and commercial kitchens. 2. Size and Versatility: The extra-large size of these cutting boards provides ample space for cutting large quantities of meat, vegetables, fruits, and other ingredients. Additionally, the set includes different-sized boards, allowing you to choose the one that suits your specific needs. The boards can also double as serving platters due to their attractive design.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2024
J
Verified Purchase
Jimfo
New York, US
★★★★★ 5
Worth the money
Size: Large-3SET
This 3-piece pre-oiled bamboo cutting board isfantastic. The carbonized bamboo gives them a rich, warm tone that looks much nicer than standard cutting boards. I really appreciate the variety of sizes. They feel sturdy without being too heavy, and they stay in place well while cutting. Cleanup is easy too—just a quick wash and they’re good to go, with no lingering odors or stains. Overall, this set offers excellent quality, functionality, and value. Great for everyday cooking and a solid upgrade from plastic boards.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
J
Verified Purchase
Jinx
New York, US
★★★★★ 5
The Best buy for my kitchen
Size: Large-3SET, Size: Large-3SET
Great quality cutting boards! The carbonized bamboo feels durable yet lightweight, and they look beautiful in the kitchen. I love that they come pre-oiled and are non-toxic. The three sizes are super practical, and the hanging hole is a nice bonus. Definitely a great buy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026

recommand products