SKU: 97418107775

GABARAPL2 His Tag Protein, Human

Sale price$182.70 Regular price$203.00
Save 10%

Pay in installments of $50.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GABARAPL2 His Tag Protein, HumanProduct Specification Species Human Synonyms ATG8L, ATG8C, GATE 16, GATE16, GEF 2, GEF2 Accession P60520 Amino Acid Sequence Met1 Phe117, with N terminal 8*His Tag MHHHHHHHHMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF. Expression System E. coli Molecular Weight 17kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms ATG8L, ATG8C, GATE-16, GATE16, GEF-2, GEF2
Accession P60520
Amino Acid Sequence

Met1-Phe117, with N-terminal 8*His Tag MHHHHHHHHMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF.

Expression System E.coli
Molecular Weight 17kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Ewing Rob M, et al. (2007) Large-scale mapping of human protein-protein interactions by mass spectrometry. Mol Syst Biol. 3(1):89. 2. Okazaki N, et al. (2000) Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain: possible role of vesicular transport in axonal elongation. Brain Res Mol Brain Res. 85(1-2):1-12. 3. Xin Y, et al. (2001) Cloning, expression patterns, and chromosome localization of three human and two mouse homologues of GABA(A) receptor-associated protein. Genomics. 74 (3):408-13.

Background

GATE-16, also known as ATG8, belongs to the MAP1 LC3 family. It is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. GATE-16 is expressed at very low levels in lung, thymus and small intestine. GATE-16 is involved in intra-Golgi traffic. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97418107775

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Chevaughn
Los Angeles, US
★★★★★ 5
Highly recommended
Color: Bright Purple
I recently purchased the OLOV Electric Body Hair Trimmer and I give it a full 5 stars! This isn’t my first time buying from OLOV—my initial purchase was for myself, and I’ve been impressed with its quality and performance. This time, I bought one for my wife, and she absolutely loves it! It’s easy to use, reliable, and delivers excellent results. Highly recommend this trimmer for anyone looking for a dependable grooming tool.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
R
Verified Purchase
ratchet
West Palm Beach, US
★★★★★ 5
Nice shaver and is easy to use.
Color: Gold &black
The olov electric body hair trimmer does a good job shaving the arms and legs but you have to be careful when shaving the private area . You have to stretch the skin on the privates as you shave between the inner thigh it will nick the skin on the scrotum.The olove is narrow enough to shave the privates.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
M
Verified Purchase
Michael Lionel
Lowell, US
★★★★★ 4
So good had to buy it twice!
Color: Gold &black
I originally bought this OLOV trimmer in October 2022, and after nearly four years of regular use, I just ordered the exact same one again. Honestly, that’s probably the strongest endorsement I can give. Up until about a month and an half ago, it worked amazingly well. Recently, it started making a buzzing sound and became noticeably less comfortable to use. It began pulling hairs, nicking skin, and generally lost the smooth performance that made me love it in the first place. I tried cleaning it thoroughly and even adding clipper oil, but the loud noise and abrasive trim problems still persist. That said, for a trimmer that costs around $30, getting almost four years of reliable use is more than fair in my book. I barely considered alternatives; I just bought another one because I didn’t want to gamble on something else for a higher entry point. A few things I really like: -Charges quickly. -Holds a charge forever. It’s literally never died on me. Great for travel, and I’ve often left the charger at home for short trips. -Easy to clean and maintain. -Comfortable to use pretty much anywhere on the body. I’ll leave that part to your imagination. 😉 -Excellent value for the money. I’ve seen some reviews mentioning broken plastic teeth on the blade, but mine never broke. No idea what caused the buzzing issue on my old unit, but after nearly four years of service, I can’t complain. Bottom line: If you’re looking for a solid body trimmer that won’t break the bank and can give you years of use, this is easily the best value trimmer I’ve personally used. For the price point, it’s worth trying to experience what a comfortable, snag-free trim is supposed to be like because, before this trimmer, I didn’t even know it was possible. I do think it’s a 5-star product when it works, but considering that mine did eventually fail, I’m giving it 4 stars. But seriously, I don’t think you can go wrong with this. Give it a try!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
R
Verified Purchase
Retail Therapy Patient
Belleville, US
★★★★★ 5
No hair tugging!
Color: Purple
I've tried a few other electric razors over the years and have always been disappointed. I hadn't shaved in a long time and hoped this would make it easier but was prepared to be disappointed. I am thrilled to say it worked amazingly. I trimmed the hair with scissors, then just ran over the skin the with lowest trimmer which left a short stubble. No hair tugging at all which is always my biggest complaint. I did nick myself once (be sure to pull the skin taught) but I can blame the learning curve for that. The razor is small enough to get everywhere but wide enough to be efficient. It is light and the handle is easy to maneuver. I used it on dry skin so I don't know how it would be in the shower. It was easy to clean with the included brush. The whole thing probably took 5 minutes which is a huge improvement from going from scissors to a regular razor. Couldn't be happier with the purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
G
Verified Purchase
Gareth Alexander
Lake Worth, US
★★★★★ 3
Blood Donors give less blood
Color: Gold &black
For the love of your hairy mansack use with caution!! After reading the description and reviews I thought I would take a chance on this cut free product. I couldn't fault the delivery as it arrived the same day. Bonus I thought a thought I lived to quickly regret! With eager anticipation I opened the package and set this gift from the hairless God's on charge. The charge time was fast and the product looked the part so with baited breath I took hold of this item and went 'downtown'.... The first few strokes were like a magician using a wand, pure magic! The trimmer effortless cut through its task in hand with precision and luring me into a sense of security that only can be achieved after several mishaps of various degrees. Oh little magic trimmer what a wonderful false sense of glee you were providing. With a new sense of bravery and belief like no other I went a little further south to smooth out the mansack like never before.. Holy Mother of Jesus hear my prayers!! Save me from this massacre that was unfolding before my eyes!! The trimmer took off its sheep's clothing and revealed the real evil within! With precision it ate up my mansack with ruthlessness never witness before. The cuts were quick and endless, the snagged skin becoming more and more frequent. The blood dripping now was making the task at hand more difficult but undeterred by the great reviews I kept going believing it was my fault just a bad technique. We will prevail! Alas prevail turned into survival and a soon to be found fetal position praying for my man parts to heal from their recent brush with a back street castration. I'm sure it's just operator error and maybe once healed I will accept the challenge again to wield this clippers and be the smooth operator it promised. In the meantime I would recommend buying several large packets of bandaid to get you through the blood donation you're about to give. On a plus side it cleaned up pretty nice and easy so all in all I'll give it 5 stars along with the body parts it took all by itself!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 26, 2022

recommand products