SKU: 49513840462

Frizzled-5/FZD5 Fc Chimera Protein, Human

Sale price$184.50 Regular price$205.00
Save 10%

Pay in installments of $51.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Frizzled-5/FZD5 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms C2orf31, Fz 5, hFz5, FzE5 Accession Q13467 Amino Acid Sequence Ala27 Pro167, with C terminal Human IgG Fc

Product Specification


Species Human
Synonyms C2orf31, Fz-5, hFz5, FzE5
Accession Q13467
Amino Acid Sequence

Ala27-Pro167, with C-terminal Human IgG Fc ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 55-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Sun Y. et al. (2020) FZD5 contributes to TNBC proliferation, DNA damage repair and stemness. Cell Death and Disease. 11: 1060.1/2

Background

FZD5, a member in Frizzled family, was identified to be preferentially expressed in TNBC (triple-negative breast cancer), and associated with unfavorable prognosis. Loss and gain of function studies revealed that FZD5 contributed to TNBC cell G1/S transition, DNA replication, DNA damage repair, survival, and stemness. Mechanistically, transcription factor FOXM1, which promoted BRCA1 and BIRC5 transcription, acted as a downstream effecter of FZD5 signaling. FOXM1 overexpression in FZD5-deficient/low TNBC cells induced FZD5-associated phenotype. Finally, Wnt7B, a specific ligand for FZD5, was shown to be involved in cell proliferation, DNA damage repair, and stemness. Taken together, FZD5 is a novel target for the development of therapeutic strategies to overcome chemoresistance and prevent recurrence in TNBC.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 49513840462

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cooper
Lowell, US
★★★★★ 5
Great upgrade
Size: 54mm Fits Breville Barista/Bambino/Infuser
I just got a Breville barista express for Christmas and was searching for upgraded tools. I stumbled across this accessory kit and was worried about the quality. I’m pleased to say I’ve very happy with the quality for the price that you get these for, all the tools are heavy and feel sturdy. My coffee is much better not. This fits the barista express perfect. The metal design is very nice in the hands and easy to use. Functions exactly as I would expect. Overall great buy for anyone looking for an affordable upgrade.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 20, 2026
L
Verified Purchase
~Life Is Beautiful~
Draper, US
★★★★★ 5
Quality well made kit, happy with my purchase
Size: 54mm Fits Breville Barista/Bambino/Infuser
I am so glad I went ahead and purchased this 7 piece espresso accessories kit! All the tools included are very well made. The tamper is exceptional, sometimes the spring can get misaligned, as I have read with pretty much all tampers, the set is made Well. I have not had any problems. I'm very well satisfied with the upgrade. The appearance is quality and feels heavy and expensive. I searched for many of these espresso accessory kits, and I'm glad that I went with this one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
A
Verified Purchase
Avi B.
Omaha, US
★★★★★ 5
Useful.Helps preparing better coffee
Size: 54mm Fits Breville Barista/Bambino/Infuser
It is high quality and contains some helpful elements.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
S
Verified Purchase
Satisfied Customer
Lowell, US
★★★★★ 4
Good value and for newbies
Size: 54mm Fits Breville Barista/Bambino/Infuser
Keep in mind I am new to the home espresso machine world, but prioritize my coffee quality. For context I am using this kit with a Breville Bambino Plus machine with an after market Teyearlife 54mm bottomless portafilter. The build quality of all of the items in the is very good. Solid feel and machined cleanly free of imperfections or rough spots. Fits both the Breville stock amd aftermarket portafilter perfectly. Really can beat the price on this kit compared to others. I would recommend washing all of the items in warm water with just tiny bit of fragrance free dish soap and disassembling the tamp and leveler to wash off the machine oil that was applied in the factory since you do not know if that is food safe or not. Mine smelled more like WD40. Just use a thin layer of butcher block or food grade mineral oil when dry and before you reassemble those items. I would have given 5 stars but three things held me back from doing so. First, the needles on the WDT tool have sharp tips and really do not need to be, so I may be cutting the tips off. Second the magnets on the portafilter funnel should be bigger, or stronger, or there should be more of them, it needs to have just a little more grab in my opinion. Third and lastly, I was hoping for some instructions or guidance on what depth to set the tamp and leveler to. So for now just kinda playing it by feel. I have pulled 2 double shots using this kit and I get good crema and consistent 45ml of espresso with 19g of fresh ground coffee. So maybe I got lucky with my first initial setting but would like to get some reference to start from. Other than that, I would say this is a good kit for those venturing into the world of espresso who do not want to spend a lot on accessories, but also want quality tools that you can grow with over time. Happy brewing!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026
T
Verified Purchase
TS
Houston, US
★★★★★ 5
Amazingly heavy duty premium quality
Size: 54mm Fits Breville Barista/Bambino/Infuser
Premium quality just don’t drop it on your toe! They are super heavy and highest quality ever
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026

recommand products