SKU: 30824331291

Siglec-15 His Tag Protein, Human

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Siglec-15 His Tag Protein, HumanProduct Specification Species Human Synonyms CD33 antigen like 3, SIGLEC 15, CD33L3, sialic acid binding Ig like lectin 15, Siglec 15 Accession Q6ZMC9 Amino Acid Sequence Phe20 Thr263, with C terminal 10*His

Product Specification


Species Human
Synonyms CD33 antigen-like 3, SIGLEC-15, CD33L3, sialic acid-binding Ig-like lectin 15, Siglec-15
Accession Q6ZMC9
Amino Acid Sequence

Phe20-Thr263, with C-terminal 10*His FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGASTGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 33-40kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

We identified Siglec-15 as a critical immune suppressor with broad upregulation on various cancer types and a potential target for cancer immunotherapy. Siglec-15 has unique molecular features compared to many other known checkpoint inhibitory ligands. It shows prominent expression on macrophages and cancer cells and a mutually exclusive expression with PD-L1, suggesting that it may be a critical immune evasion mechanism in PD-L1 negative patients. Interestingly, Siglec-15 has also been identified as a key regulator for osteoclast differentiation and may have potential implications in bone disorders not limited to osteoporosis. As a new player in the cancer immunotherapeutic arena, Siglec-15 may represent a novel class of immune inhibitors with tumor-associated expression and divergent mechanisms of action to PD-L1, with potential implications in anti-PD-1/PD-L1 resistant patients.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 30824331291

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Norman Nickle
West Palm Beach, US
★★★★★ 5
Lightweight and great color!
Size: XX-Large, Color: (870) Orange Bloc / / Black, Size: XX-Large, Color: (870) Orange Bloc / / Black
Perfect for my husbands trail race! He was cool and cute the whole time! He bragged about how lightweight and comfortable it was, however I would take note that the material is thin. We wanted that to keep cool, however, I could see this wearing out for some depending on your workout. For running it was great and super good value for what we paid.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
S
Verified Purchase
Sean
Draper, US
★★★★★ 5
Great first layer. True to size.
Size: 3X-Large Tall, Color: Gray
They fit nicely as a first layer underneath a T-shirt. Great for my purpose which was a extra layer for machining lab days where we cannot have long sleeves.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
R
Verified Purchase
Rustybeatz87
Carnegie, US
★★★★★ 4
Great fit doe your workout
Size: Medium, Color: Black (001)/Graphite
Great shirt and feels great during my workouts. Fits just about to the size. I wear a medium and it’s a little loose but not bad.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
T
Verified Purchase
TCM
Louisville, US
★★★★★ 5
Good Basic Athletic Shirt
Size: Small, Color: Gray (002)/Black
These shirts (I have six) are all they should be, and, for the price, an excellent choice for a regular workout or running shirt. Nothing too flashy. Washes well. Doesn't shrink or wrinkle. May run a tad small.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
P
Verified Purchase
PrimingFX
Houston, US
★★★★★ 5
Fits great
Size: 3X-Large, Color: Black, Size: 3X-Large, Color: Black
Ah, let me spin you a yarn about the Under Armour Men's Tech 2.0 Short-sleeve T-shirt – the sultan of comfort, the maestro of moisture-wicking, and the unsung hero of casual wear that will make you question why you ever settled for less in the realm of T-shirts. First and foremost, let's talk about the fabric – it's like wrapping yourself in a cloud woven from the threads of a thousand cotton candy dreams. The Tech 2.0 T-shirt caresses your skin with the tenderness of a gentle breeze, making you wonder if you accidentally stumbled upon a secret society of clothing wizards who specialize in the art of softness. The fit is like a custom-tailored suit for your torso. It hugs you in all the right places without making you feel like a sausage casing or a misplaced balloon animal. I've worn it for everything from impromptu dance-offs to intense staring contests with the refrigerator, and it never once betrayed my aesthetic sensibilities. It's the kind of fit that says, "Yes, I work out, and yes, I also enjoy pizza. Balance, my friends, balance." Now, let's delve into the realm of moisture-wicking technology – a.k.a. the superhero cape of T-shirt features. I've worn this shirt through sweaty gym sessions, summer heatwaves, and surprise encounters with old acquaintances that induce nervous perspiration. And yet, it remains drier than a stand-up comedy show in a desert. It's practically a magical force field against sweat – the kind of sorcery that leaves you feeling fresher than a daisy in a rain shower. But the real showstopper is the Anti-Odor technology. It's like the T-shirt gods sprinkled a bit of enchantment into the fabric, ensuring that no matter how much you exert yourself, you'll smell as fresh as a mountain breeze. I've worn it for consecutive days – don't judge; laundry is a social construct – and emerged smelling like a field of wildflowers. And let's not forget the humor in this T-shirt masterpiece. The Under Armour logo is like a subtle flex, a tiny symbol that says, "I take my comfort seriously, but I'm also low-key athletic." It's the T-shirt equivalent of a wink and a nod, a fashion statement that knows how to have a good time. In conclusion, the Under Armour Men's Tech 2.0 Short-sleeve T-shirt isn't just a T-shirt; it's a lifestyle upgrade. With a comfort level that defies earthly standards, moisture-wicking prowess that mocks the very concept of sweat, and a dash of humor in its branding, it's the shirt you never knew you needed until you experienced the cottony embrace of greatness. So, fellow T-shirt connoisseurs, let the Tech 2.0 redefine your torso's expectations – where every wear is a journey into the luxurious realms of fabric excellence!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 9, 2023

recommand products