SKU: 22810674892

Biotinylated BCMA His&Avi Tag Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Pay in installments of $64.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated BCMA His&Avi Tag Protein, HumanProduct Specification Species Human Antigen BCMA Synonyms TNFRSF17, CD269, BCM, BCMA Accession Q02223 1 Amino Acid Sequence Met1 Ala54, with C terminal His&Avi Tag MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAGGGSHHHHHHHHGLNDIFEAQKIEWHE Expression System HEK293 Molecular Weight 15 17kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Biotin Tag Avi Tag, His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Human
Antigen BCMA
Synonyms TNFRSF17, CD269, BCM, BCMA
Accession Q02223-1
Amino Acid Sequence

Met1-Ala54, with C-terminal His&Avi Tag MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAGGGSHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

15-17kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Nina Shah, Ajai Chari, Emma Scott, Khalid Mezzi & Saad Z. Usmani: B-cell maturation antigen (BCMA) in multiple myeloma: rationale for targeting and current therapeutic approaches, Leukemia volume 34, pages985-1005 (2020).

Background

BCMA (The B-cell maturation antigen), also designated as TNFRSF17, belongs to the tumor necrosis factor receptor superfamily, which is a family of cytokine receptors. BCMA is encoded by a 2.92-kb TNFRSF17 gene located on the short arm of chromosome 16 (16p13.13) and composed of 3 exons separated by 2 introns. There are four natural splice variants of human BCMA that present with different receptor binding affinities, membrane-anchoring ability, and intracellular domain signaling. BCMA main ligands are the cytokines B-cell activating factor and a proliferation-inducing ligand. The interaction between BCMA and its ligands activates the NF-κB signaling pathway that plays an important role in B-cell proliferation and maturation and is essential for the survival of long-lived bone marrow plasma cells. BCMA is expressed preferentially on mature B cells and has minimal expression on hematopoietic stem cells or other cell types. The BCMA has emerged as a central target in multiple myeloma (MM). In preclinical studies, overexpression of BCMA and the interaction with is ligand, a proliferation-inducing ligand (APRIL), was found to promote MM progression in vivo and augment MM cell growth and survival through induction of multiple signaling cascades, including protein kinase B (AKT), MAPK, and nuclear factor (NF)-κB. Additionally, BCMA has been shown to be solubilized at high levels in serum of patients with MM (sBCMA). This form of sBCMA binds to B-cell activating factor (BAFF). The role of BAFF is to stimulate normal B-cell and plasma cell development; however, this functioning is prevented when it is bound by BCMA in the serum, thereby leading to decreased polyclonal immunoglobulin levels in patients with MM.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 22810674892

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cheryl J
Lexington, US
★★★★★ 5
Great story, beautiful pics
Format: Board book
Perfect book to go into a baby shower gift basket. Nice pictures and love the board book
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
S
Verified Purchase
Shanise
Cuba, US
★★★★★ 5
Good quality book
Format: Board book
I wanted a book that can be a keep sake for my baby. This one is, it is well made and of good quality. I love the little story I read it to my newborn everyday. I love how calm the drawing and even the colors in this book are makes the images less overestimating.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 5, 2026
L
Verified Purchase
Lady B
Louisville, US
★★★★★ 5
The Illustrations are Sweet, Storyline… Great!
Format: Board book
This book is sturdy and has a wonderful message. My grandchildren love it! If you are the one who presents 2 children in a classroom or other setting, most children will really love this book. The durability of the book is great. The illustrations are sweet. The review platform does not allow for me to enter an age span. It does not allow for me to enter multiple ages. It seems to force you to Select one age. I would say that having raised children of my own, I would start reading this book by one years old, but the average child I guess would best benefit with between ages like two and four. The book could be read up to people who are like six years old if they just love a sweet bedtime story.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
V
Verified Purchase
Vickie D. Roderick
West Palm Beach, US
★★★★★ 5
Ms V
Format: Board book
Awesome book for my nephew. The book is good for a new reader to learn words from.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
G
Verified Purchase
Gin
Battle Creek, US
★★★★★ 5
Great quality
Format: Board book
Sweet little book . Color is vibrant and quality is extremely nice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026

recommand products