SKU: 2236039303

Biotinylated Her3 His&Avi Tag Protein, Human

Sale price$210.60 Regular price$234.00
Save 10%

Pay in installments of $58.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated Her3 His&Avi Tag Protein, HumanProduct Specification Species Human Synonyms Her3, FERLK, LCCS2, VSCN1 Accession P21860 Amino Acid Sequence Ser20 Thr643, with C terminal 10*His &Avi tag

Product Specification


Species Human
Synonyms Her3, FERLK, LCCS2, VSCN1
Accession P21860
Amino Acid Sequence

Ser20-Thr643, with C-terminal 10*His &Avi tag SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTGGGSHHHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

90-95kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Zhang N. et al. (2016) HER3/ErbB3, an emerging cancer therapeutic target. Acta Biochim Biophys Sin. 48(1): 39-48.

Background

HER3 is a member of the HER (EGFR/ErbB) receptor family consisting of four closely related type 1 transmembrane receptors (EGFR, HER2, HER3, and HER4). HER receptors are part of a complex signaling network intertwined with the Ras/Raf/MAPK, PI3K/AKT, JAK/STAT, and PKC signaling pathways. Aberrant activation of the HER receptors and downstream signaling molecules tips the balance on cellular events, leading to various types of cancers. The HER3 protein is expressed in several types of tumors. That fact, together with the role of HER3 in promoting cell proliferation, implicate that targeting HER3 may have therapeutic relevance. Furthermore, expression and activation of HER3 has been linked to resistance to drugs that target other HER receptors such as agents that act on EGFR or HER2.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2236039303

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Renae Halvorson
San Leandro, US
★★★★★ 4
Value for your money
Style: EcoFetch
It's definitely different from the one I lost. It's taking me some time how to throw the ball correctly. It's a hit and miss but we are getting there. When I do get a good throw, it really wings it out there.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
W
Verified Purchase
Will Brannies
Port Orchard, US
★★★★★ 5
Well worth it
Style: EcoFetch
Works great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
L
Verified Purchase
Leslie Guffey
Los Angeles, US
★★★★★ 5
Light up and glow in the dark ball
Size: One-Size-for-Most
Definitely my girls favorite ball 😀. It disappears and I have to buy another one or she goes nuts. Glows in the dark, brighter with more sun. The bounce light up don’t last a real long time, too quick to quit for her but still loves it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
A
Verified Purchase
AirNelson
Los Angeles, US
★★★★★ 5
Durable & Bright - Great for Heavy Chewers
Size: One-Size-for-Most
Pros: Extremely Durable: Survived an aggressive chewer where tennis balls failed. Dual-Visibility: Features both internal flashing lights and a glow-in-the-dark "chargeable" surface. Perfect Size: Fits comfortably in the mouth of a 40lb medium-sized dog. Same size as a tennis ball. Cons: Battery Life: Unsure how long the internal flashing lights will last (though it has held up well so far).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2026
A
Verified Purchase
Andrea S.
Alexandria, US
★★★★★ 5
Great for night time play!
Size: One-Size-for-Most
This ball is great! It is a 2-for-one light up feature so we love the flashing lights and if she drops it in the snow after those lights stop, we can still find it because of the strong glow that gets its charge from the flashing LED lights. Our first one lasted a few years, we lost it on a trip so now back for our second one so we can keep the night time fetch going! She is a golden retriever for size reference. Any bigger of a breed and I would worry it might be too small for her mouth. It’s a bit smaller than a tennis ball. Just don’t make the same mistake I did and let them have it in the house at night, she walked up to my bedside while I was asleep one night and squeezed it to activate it. Those lights are so bright it was a rude awakening!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 11, 2025

recommand products