SKU: 2944776604

uPAR/CD87 His Tag Protein, Mouse

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

uPAR/CD87 His Tag Protein, MouseProduct Specification Species Mouse Antigen uPAR CD87 Synonyms Monocyte activation antigen Mo3, U PAR, uPAR, CD8, Urokinase Type Plasminogen Activator (UPA) Receptor, URKR, U Plasminogen Activator Receptor Form 2, CD87 Antigen, Plasminogen Activator, Urokinase Receptor, MO3 Accession P35456 Amino Acid Sequence Leu24 Gly298, with C terminal 8*His

Product Specification


Species Mouse
Antigen uPAR/CD87
Synonyms Monocyte activation antigen Mo3, U-PAR, uPAR, CD8, Urokinase-Type Plasminogen Activator (UPA) Receptor, URKR, U-Plasminogen Activator Receptor Form 2, CD87 Antigen, Plasminogen Activator, Urokinase Receptor, MO3
Accession P35456
Amino Acid Sequence

Leu24-Gly298, with C-terminal 8*His LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPTGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

45-70kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Desmedt, S. et al. (2017) Crit. Rev. Clin. Lab. Sci. 54:117.2.Smith, H. et al. (2010) Nat Rev Mol Cell Biol 11:23.

Background

Urokinase plasminogen activator surface receptor (U-PAR) is also known as PLAUR, Monocyte activation antigen Mo3, CD antigen CD87.The urokinase-type Plasminogen Activator (uPA) is one of two activators that converts the extracellular zymogen plasminogen to plasmin, a serine protease that is involved in a variety of normal and pathological processes that require cell migration and/or tissue destruction. uPA is synthesized and released from cells as a single-chain (sc) pro-enzyme with limited enzymatic activity and is converted to an active two-chain (tc) disulfide-linked active enzyme by plasmin and other specific proteinases. Both the scuPA and tcuPA bind with high-affinity to the cell surface via the glycosyl phosphatidylinositol-linked receptor uPAR which serves to localize the uPA proteolytic activity. The enzymatic activity of scuPA has also been shown to be enhanced by binding to uPAR. Independent of their proteolytic activity, the uPA/uPAR interaction also initiates signal transduction responses resulting in activation of protein tyrosine kinases, gene expression, cell adhesion, and chemotaxis. uPAR can interact with integrins to suppress normal integrin adhesive function and promote adhesion to vitronectin through a high affinity vitronectin binding site on uPAR. The uPA/uPAR interaction initiates signal transduction responses resulting in activation of protein tyrosine kinases, gene expression, cell adhesion, and chemotaxis. uPAR can interact with integrins to suppress normal integrin adhesive function and promote adhesion to vitronectin through a high affinity vitronectin binding site on uPAR. uPAR is considered as a biomarker in many inflammatory diseases including cancer, cardiovascular diseases, chronic kidney diseases and diabetes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2944776604

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cherished1
Phoenix, US
★★★★★ 5
Epson SureColor F170 Sublimation Printer Rocks!
Style: Printer & Inks, Style: Printer & Inks
TI’m a newbie at sublimation, and this is my first sublimation printer. I love it! I can’t wait to make more things! I like that it’s not too large, but still can print up to 8.5x14”. The quality seems to be really good, but I also don’t have any other printer to compare it to. This was my very first project! I’m very happy with it so far!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
B
Verified Purchase
B.Nicole
Lake Worth, US
★★★★★ 5
My Go-To Sublimation Paper — Flawless Results Every Time
Size: 8.5"x11", Size: 8.5"x11"
This is hands down the best sublimation paper I’ve used and the only one I continue to buy. I get a perfect transfer every single time—no fracturing, no fading, and no uneven results. The paper dries fast, which makes my workflow so much smoother, especially when I’m producing items in batches. I use this regularly to make air fresheners and tote bags for my small business, and the color payoff is always vibrant and crisp. The transfer rate is excellent, and it works beautifully on light-colored, high-quality polyester and other sublimation-ready surfaces. If you’re a small business owner or crafter who values consistency, quality, and ease of use, this paper is absolutely worth it. I highly recommend it and will continue to repurchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2026
J
Verified Purchase
Jimmy
Lexington, US
★★★★★ 5
Best Sublimation Paper
Size: 8.5"x11"
I’ve been using A-Sub paper for my sublimation projects, and it is easily one of the best. The ink dries almost instantly once printed, so I don’t have to worry about smudging the design or getting those annoying "pizza wheel" marks from the printer rollers. The paper itself feels substantial and doesn't tear or curl easily. One of the biggest wins for me is that it never jams; it feeds through perfectly every time, saving me the frustration of wasting expensive ink and paper. When I go to press my designs, the ink releases almost completely, leaving very little behind on the paper and putting all that color onto the project. The final results look super professional, with colors that are vibrant and sharp rather than looking faded or dull. It has worked perfectly for everything I’ve tried so far, and if you want a reliable paper that gives you consistent, high-quality results, this is definitely the one to get.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
N
Verified Purchase
Nadiagne
Cuba, US
★★★★★ 5
Ideal for sublimation beginners.
Size: 8.5"x11"
Asub sublimation paper has been excellent for my projects. The ink transfer is very good, the colors are vibrant and defined, and it dries quickly. It has helped me achieve clean and professional results, even as a beginner. Without a doubt, it's a reliable, high-quality paper for sublimation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026
C
Verified Purchase
Chiller Leonard
Whiting, US
★★★★★ 5
Excellent works great and I’m bang for your buck
Size: 8.5"x14"
I love this paper. It prints, nice and clear I will be buying more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026

recommand products