SKU: 14263026824

Galectin-9 His Tag Protein, Human

Sale price$288.90 Regular price$321.00
Save 10%

Pay in installments of $80.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Galectin-9 His Tag Protein, HumanProduct Specification Species Human Antigen Galectin 9 Synonyms Gal 9, Ecalectin, Tumor antigen HOM HD 21 Accession O00182 2 Amino Acid Sequence Ala2 Thr323, with N terminal 8* His

Product Specification


Species Human
Antigen Galectin-9
Synonyms Gal-9, Ecalectin, Tumor antigen HOM-HD-21
Accession O00182-2
Amino Acid Sequence

Ala2-Thr323, with N-terminal 8* His

HHHHHHHHAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Expression System HEK293
Molecular Weight

47-55kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Iwasaki-Hozumi H., Chagan-Yasutan H., Ashino Y., Hattori T. Blood Levelsof Galectin-9, an Immuno-Regulating Molecule, Reflect the Severity for theAcute and Chronic Infectious Diseases. Biomolecules. 2021;11:430.

2.Nishi N., Itoh A., Fujiyama A., Yoshida N., Araya S.-i., Hirashima M.,Shoji H., Nakamura T. Development of highly stable galectins: Truncation of thelinker peptide confers protease-resistance on tandem-repeat type galectins.FEBS Lett. 2005;579:2058–2064.

3.Oomizu S., Arikawa T., Niki T., Kadowaki T., Ueno M., Nishi N., Yamauchi A., HirashimaM. Galectin-9 suppresses Th17 cell development in an IL-2-dependent butTim-3-independent manner. Clin. Immunol. 2012;143:51–58. d

4.Bozorgmehr N., Mashhouri S., Perez Rosero E., Xu L., Shahbaz S., Sligl W.,Osman M., Kutsogiannis D.J., MacIntyre E., O’Neil C.R., et al. Galectin-9, aPlayer in Cytokine Release Syndrome and a Surrogate Diagnostic Biomarker inSARS-CoV-2 Infection. mBio. 2021;12:e00384-21.


Background

Galectin-9 is a β-galactoside binding lectin known for its immunomodulatory role in various microbial infections. Gal-9 is expressed in all organ systems and localized in the nucleus, cell surface, cytoplasm and the extracellular matrix. Gal-9 structurally consists of two homologous carbohydrate-recognition domains at the N- and C-terminus (NCRD and CCRD, respectively) linked by a linker peptide that is highly susceptible to proteolysis. It mediates host-pathogen interactions and regulates cell signalling via binding to its receptors. Gal-9 is involved in many physiological functions such as cell growth, differentiation, adhesion, communication and death. Gal-9 is a molecule that positively and negatively adjusts immune systems as both a contributing factor in cytokine storm and an immunosuppressive molecule inducing, for instance, T-cell exhaustion and apoptosis.


Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 14263026824

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Ciara
Battle Creek, US
★★★★★ 5
Perfect suit for boys
Color: Navy Blue, Size: 12 Years, Color: Navy Blue, Size: 12 Years
So thankful for this! This suit was perfect! My son wore this all night playing and the durability of this fabric is on another level. Wasn't too thick, looked really nice, and fabric was really soft. It also blended really well with the suits from Mens Warehouse.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
J
Verified Purchase
Jessica
Port Orchard, US
★★★★★ 5
Perfect!
Color: Royal Blue, Size: 12 Years, Color: Royal Blue, Size: 12 Years
I was nervous about purchasing something like this at the last minute. But based on the previous reviews I decided to take a chance. The suit is nice and the material feels really good. Not thin or cheap at all. My son looked so handsome and grown up. He’s on the slim side so he does have extra room but I don’t mind it because he can definitely grow into it. I did purchase a separate tie because I wanted a pattern to complement the blue. I’d definitely purchase again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
A
Verified Purchase
Angelbaby
Lexington, US
★★★★★ 4
Big in waist
Color: Grey, Size: 12 Years
Very nice suit, the material was nice. My son is an average build, the suit fit on the length but unfortunately the pants were huge in the waist. Even with the inside waist adjuster and a belt he couldn't wear them. Which was disappointing because overall the rest of the suit was perfect!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
M
Verified Purchase
Mckayla
Port Orchard, US
★★★★★ 5
Perfect
Color: Royal Blue, Size: 8 Years
The tops fit perfectly however my 6 year old is very tall and slim so the pants were a little big but at least the adjustable straps on the inside will help..love the color
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
T
Verified Purchase
tonye andrews
Pawtucket, US
★★★★★ 5
Worth the money
Color: Navy Blue, Size: 12 Years, Color: Navy Blue, Size: 12 Years
Came just in time for my son graduation and he was very sharp and handsome
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026

recommand products