SKU: 99563117142

RON/CD136 His Tag Protein, Human

Sale price$277.20 Regular price$308.00
Save 10%

Pay in installments of $77.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

RON/CD136 His Tag Protein, HumanProduct Specification Species Human Synonyms RON, CD136, MSP R, MSP receptor, MSPR, MST1R Accession Q04912 Amino Acid Sequence Glu25 Leu571, with C terminal 10*His

Product Specification


Species Human
Synonyms RON, CD136, MSP R, MSP receptor, MSPR, MST1R
Accession Q04912
Amino Acid Sequence Glu25-Leu571, with C-terminal 10*His EDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNTSCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPGSWQQDHCPPKLGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 35-43&73-80kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Mallakin A. et al. (2006) Gene expression profiles of Mst1r-deficient mice during nickel-induced acute lung injury. Am J Respir Cell Mol Biol. 34(1): 15-27.

2、Welm A L. et al. (2007) The macrophage-stimulating protein pathway promotes metastasis in a mouse model for breast cancer and predicts poor prognosis in humans. Proc Natl Acad Sci U S A. 104(18): 7570-5.

Background

RON is a receptor tyrosine kinase (RTK) of the MET receptor family that is canonically involved in mediating growth and inflammatory signaling. This gene encodes a cell surface receptor for macrophage-stimulating protein (MSP) with tyrosine kinase activity. The mature form of this protein is a heterodimer of disulfide-linked alpha and beta subunits, generated by proteolytic cleavage of a single-chain precursor. It had been shown that MST1R/CD136 plays a critical role in Ni-induced lung injury in mice. The overexpression of MSP, MT-SP1, and MST1R was a strong independent indicator of both metastasis and death in human breast cancer patients and significantly increased the accuracy of an existing gene expression signature for poor prognosis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 99563117142

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jesse Arner
Lowell, US
★★★★★ 4
A hit, but could be stronger
Size: Medium, Color: Ring Bone, Size: Medium, Color: Ring Bone
Gave this to my 11 week old pittie, and she did significant damage within 15 mins. She left a pile of chewed bits on the couch but thankfully didn't eat them. Definitely don't leave unsupervised. That said, she LOVED it and it seemed to help her teething gums so, I'm still giving it a 4/5 Puppy pics for tax
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
A
Verified Purchase
Amazon Customer
Massapequa, US
★★★★★ 5
FOR SHORT TIME USE
Size: X-Small, Color: Ring Bone
My puppies love this. After a couple of weeks, it is worn so I throw it out and buy another since it's reasonably priced. I don't want them to actually ingest a chunk of this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
B
Verified Purchase
Brandy B
Boise, US
★★★★★ 5
Great for our puppy
Size: X-Small, Color: Ring Bone
This chew toy has quickly become our puppy’s absolute favorite. She’s just starting to teethe, and keeping her busy and comfortable has definitely been a challenge, but this ring has been a lifesaver. She was interested in it right away and keeps coming back to it on her own, which is a huge win. The chicken flavor seems to really hold her attention, and it gives her something appropriate to chew instead of everything else. It’s the perfect size for a very young puppy and easy for her to hold and gnaw on without getting frustrated. It keeps her occupied, helps soothe her gums, and gives us a much-needed break during those teething moments. If you have a puppy just starting the teething phase and need something safe, durable, and engaging, this is an excellent choice and one I’d happily buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 6, 2026
G
Verified Purchase
Ginger Murdough
Lake Worth, US
★★★★★ 5
Nylabone Ring Bone
Size: X-Small, Color: Ring Bone
My dog loves these. She chews them into pieces which helps keep her teeth clean. It is a mess to clean up. She chews and spits out the pieces. She is 6 years old so not a puppy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
M
Verified Purchase
Michelle Kim
Lowell, US
★★★★★ 4
Everything a Teething Puppy Could Need — Well-Thought-Out Kit
Size: X-Small, Color: Teething Bone
The Nylabone New Puppy Starter Kit is a solid all-in-one solution for the first few months of puppy ownership. It comes with multiple chew toys and bones designed specifically for teething puppies, and my little one took to them right away. The variety keeps him engaged, and I appreciate that each item is designed to be gentle on developing teeth while still satisfying his urge to chew. What differentiates this kit from other puppy chew sets on Amazon is the thoughtful selection of textures and shapes. It’s clear these toys are designed to stimulate gums, promote healthy chewing habits, and even support dental care. I also like that everything is non-toxic and durable enough to survive a few enthusiastic chews. The only reason I didn’t give 5 stars is that the kit might be a bit small for larger breeds, or for puppies that are particularly aggressive chewers. But for standard small to medium pups, it’s a fantastic starter kit that keeps both puppy and owner happy. ✅ Bottom line: A reliable, well-designed starter kit for teething puppies which is thoughtful, durable, and engaging. Makes a great gift for new puppy owners or a practical addition to your own puppy’s toy collection.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 26, 2025

recommand products