SKU: 11689938172

H5N1 HA (A/Hong Kong/483/97) His Tag Protein

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

H5N1 HA (A/Hong Kong/483/97) His Tag ProteinProduct Specification Species H5N1 Antigen HA Hemagglutinin Synonyms Hemagglutinin, HA Accession O92930 Amino Acid Sequence Ser405 Val520, with N terminal 8*His HHHHHHHHGGGSSGEQGVKGEKGERGENSVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV Expression System HEK293 Molecular Weight 72 80 43 55 25 30kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species H5N1
Antigen HA/Hemagglutinin
Synonyms Hemagglutinin, HA
Accession O92930
Amino Acid Sequence

Ser405-Val520, with N-terminal 8*His

HHHHHHHHGGGSSGEQGVKGEKGERGENSVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV


Expression System HEK293
Molecular Weight

72-80 43-55 25-30kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Michal Lazniewski, M. et al. (2018) Briefings inFunctional Genomics 17:415.

2. Sriwilaijaroen, N. and Suzuki, Y. (2012) Proc. Jpn. Acad. Ser. B. Phys.Biol Sci. 88:226.

3. Chang, Y.J. et al. (2021) Sci Rep 11:8637.


Background

Neuraminidase (NA) and hemagglutinin (HA) are major membrane glycoproteins found on the surface of influenza virus. Hemagglutinin binds to the sialic acid-containing receptors on the surface of host cells during initial infection and at the end of an infectious cycle. Hemagglutinin also plays a major role in the determination of host range restriction and virulence. As a class I viral fusion protein, hemagglutinin is responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization either through clathrin-dependent endocytosis or through clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.




Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 11689938172

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Savvy shopper
Los Angeles, US
★★★★★ 5
Great mineral sunscreen
Style: SPF 50 Lotion, Size: 6 Ounce (Pack of 1)
Great mineral sunscreen, rubs in well, protects well during high UV times, doesn't sweat off, not strong smell. Used this for fist time on a 95% high humidifier day while walking around Pittsburgh between 11am-3pm. No burning at all. There is a film left but that's for almost all sunscreen, so not any difference with this one. Easy to rub in and may leave a slight white coat but not as noticeable as some other mineral products. I will buy this again and recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 19, 2025
A
Verified Purchase
Ann Roth
Alexandria, US
★★★★★ 5
This stuff works
Style: SPF 50 Lotion, Size: 6 Ounce (Pack of 1)
I really like this product. It feels good on the skin and really works.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
R
Verified Purchase
RJT
Dallas, US
★★★★★ 5
One of the bests
I’m a full time trucker and I wear sunscreen everyday. In my opinion, this is the best sunscreen out there. It feels like makeup primer on skin, it dries clear. The white cast has always been a turn off for me looking like a geisha to work or the white cast residue on the collar was icky. Although this feels oily and shiny a bit glass skin but not sticky just powdery feel. I recommend it 👍🏻
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2025
D
Verified Purchase
Dobee
West Palm Beach, US
★★★★★ 5
GREAT COVERAGE!
Even, protective coverage. Great SPF to keep you safe from damaging UV! I apply evenly over face, let set, then I can put my makeup on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 2, 2025
P
Verified Purchase
PJ
Whiting, US
★★★★★ 3
Not for oily skin
Not the best for oily skin. No matter how little I put on, it feels greasy and makes me look so shiny. This is even after I put on sunscreen setting powder. I’ll keep it and use it for days I’m not in the sun much. The days I am outside a lot, I will have to stick to my black girl matte sunscreen.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 16, 2025

recommand products