SKU: 9800337854

CD7 His Tag Protein, Human

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 2 - Sep 7

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD7 His Tag Protein, HumanProduct Specification Species Human Antigen CD7 Synonyms CD7, GP40, TP41, LEU 9, Tp40 Accession P09564 Amino Acid Sequence Ala26 Pro180, with C terminal 8*His AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPGGGSHHHHHHHH Expression System HEK293 Molecular Weight 30 35kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His

Product Specification


Species Human
Antigen CD7
Synonyms CD7, GP40, TP41, LEU-9, Tp40
Accession P09564
Amino Acid Sequence

Ala26-Pro180, with C-terminal 8*His AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

30-35kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Sempowski G D. et al. (1999) Resistance of CD7-deficient mice to lipopolysaccharide-induced shock syndromes. J Exp Med. 189(6): 1011-1016.

Background

CD7 is a 40-kD member of the Ig gene superfamily that is expressed on a major subset of human peripheral T lymphocytes and NK cells. CD7 is an early T cell activation antigen in that CD7 mRNA levels rise within 15 min after initiation of a transmembrane calcium ion flux. CD7 can complex with CD3 and CD45 molecules, and CD7 signaling involves both protein kinase C and protein tyrosine kinase. CD7 has been shown to be a functional signal-transducing molecule on resting NK cells. Antibody cross-linking of NK cell CD7 induced increases in free cytoplasmic calcium, secretion of IFN-γ, NK cell proliferation, adhesion to fibronectin, and NK cytotoxic activity. Although the above studies have demonstrated in vitro roles for CD7 in T and NK cell activation and/or adhesion, relevant functions of CD7 in vivo remain unknown.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9800337854

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lana Cannon
Louisville, US
★★★★★ 5
Adjustable pillows
Color: Cooling Blue Cover, Size: Queen (Pack of 2)
I love these because they don't go flat. You can pull out whatever you need to make them comfy for you. They come in two different layers. So you have that protective cover over the main case that holds the memory foam. They're amazing to sleep on. I have had these last for years without going flat. If you hate flat pillows this is the way to go. They are very easy to wash. You just have to separate layers. They are very thick, you can adjust the thickness. Everyone in my house has at least one. They are worth the money. I have never had to replace them, because they went flat.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
A
Verified Purchase
A
Port Orchard, US
★★★★★ 4
Good pillows
Color: Cooling Blue Cover, Size: Queen (Pack of 2)
Takes some getting used to but and the cooling doesn’t last very long in my opinion, but overall amazing comfy pillows. The materials are good and are washable. I mostly stopped waking up with a stiff neck and back.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
J
Verified Purchase
Jonathan
Lake Worth, US
★★★★★ 5
Believe the Reviews
Color: Cooling Blue Cover, Size: King (Pack of 2)
I purchased these pillows because we were in need of new pillows, I previously had allswell pillows which were from walmart and they were good to start but now they tragically became very sparse and it started to effect my sleep so I saw these after careful review on other pillows and reviews I came across these and I saw some reviews and videos and I ordered them.. first they are king size we ordered they are perfect for the bed, they are plump and soft, they are memory foam which has always worked out for me for support and kept it’s shape these are great it did have a little smell I guess from packaging but other than that they are a huge upgrade from what we had before! I’m excited because they are cooling too! for the price point can’t beat it and this is coming from someone who was about to spend money on a purple pillow this will be good for now definitely buy it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
P
Verified Purchase
PilarC
Birmingham, US
★★★★★ 3
Inconsistent
Color: Cooling Blue Cover, Size: Queen (Pack of 2)
Ive ordered two different batches of these pillows, the first was a 2 pack, the second batch was a 4 pack. The pillows that came in the 2 pack have a different quality to them. The memory foam feels thicker, takes long to depress and to spring back to form. It offers more resistance, a heavier odor (at the start), and was the pillow that I fell in love with. Things changed when I ordered the 4 pack a couple months later. There was an inconsistency between the foam in these two different batches. both sets of pillows are comfortable. The first batch being firmer means I had to remove more foam before it became comfortable but the 2nd batch being more springy, I was able to keep all the foam inside. I docked a couple stars because I’m not able to provide a consistent experience with these pillows across all three beds in my home. If you need a pillow, order a set and be happy. If you want a bunch of memory foam pillows throughout your house, maybe look elsewhere as these may not all be identical.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 17, 2026
M
Verified Purchase
Mari
Los Angeles, US
★★★★★ 5
Very cool and comfortable pillows. Great value.
Color: Cooling Blue Cover, Size: Queen (Pack of 2)
These pillows are everything described on the site. They do retain shape and don’t flatten out after sleeping all night. They are nice and clean looking and comfortable. The fit on my king size bed is perfect cause I prefer the size to king size. Haven’t had to wash them yet but I have had other pillows with the same material inside and the wash ability is great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026

recommand products