Pay in installments of $76.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 2 - Sep 7
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Biotinylated B7-2 Fc&Avi Tag Protein, HumanProduct Specification Species Human Antigen B7 2 Synonyms CD28LG2, B7 2, CD86, B70, LAB72, MGC34413 Accession P42081 Amino Acid Sequence Leu26 Pro247, with C terminal Human IgG1 Fc &Avi tag
Product Specification
| Species | Human |
| Antigen | B7-2 |
| Synonyms | CD28LG2, B7-2, CD86, B70, LAB72, MGC34413 |
| Accession | P42081 |
| Amino Acid Sequence |
Leu26-Pro247, with C-terminal Human IgG1 Fc &Avi tag LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE
|
| Expression System | HEK293 |
| Molecular Weight | 72-85kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Biotin |
| Tag | Human Fc Tag, Avi Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1.Chia-Lin Chen, Jeffrey Y. Huang, Chun-HsiangWang, Stanley M Tahara, Lin Zhou, Yasuteru Kondo, Joel Schechter, Lishan Su,Michael M C. Lai, Takaji Wakita, François-Loïc Cosset, Jae U Jung & KeigoMachida: Hepatitis C virus has a genetically determined lymphotropism throughco-receptor B7.2, NatureCommunications volume 8, Article number: 13882 (2017). |
Background
CD86 is a well-known costimulatory molecule in its interaction with CD28 and/or CTLA present on T cells, and is essential for full activation of naive T-cell and subsequent differentiation. Usually, the B7 molecules are expressed mainly on APCs and B cells and in specific conditions on other activated cells. These costimulatory molecules are involved in the development of allergic inflammation and airways hyperreactivity (AHR) in allergen-challenged mice. Activated T cells, CD4+CD25+, express CD86 in the first 60 minutes after the specific inhalation exposure. These T cells can be relevant in IgE mediated allergic reaction possibly by an autocrine co-stimulation via CD28/CTLA activation pathway. The blockage of the expression of CD86 could be a potential therapeutical target to reduce the magnitude or the progression of the allergic reaction.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy