SKU: 961189109

Human Neurogranin Protein, hFc tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Neurogranin Protein, hFc tagProduct Specification Species Human Synonyms Ng, RC3, NRGN Accession Q92686 Amino Acid Sequence Protein sequence (Q92686, Met1 Asp78, with C hFc tag) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD Expression System HEK293 Molecular Weight Predicted MW: 34. 5 kDa Observed MW: 43 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag with C hFc tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Synonyms Ng, RC3, NRGN
Accession Q92686
Amino Acid Sequence

Protein sequence (Q92686, Met1-Asp78, with C-hFc tag) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD

Expression System HEK293
Molecular Weight Predicted MW: 34.5 kDa Observed MW: 43 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Neurogranin is a small, acidic protein that is highly expressed in the central nervous system, particularly in neurons. It plays a pivotal role in synaptic plasticity, which is fundamental for learning and memory processes. Located in the postsynaptic density of excitatory synapses, Neurogranin binds to calmodulin. This binding is calcium - dependent. When intracellular calcium levels rise in response to neuronal activity, calcium - calmodulin complexes form. Neurogranin's interaction with calmodulin then modulates the activity of protein kinase C (PKC), an enzyme involved in signal transduction pathways. By regulating PKC, Neurogranin influences the phosphorylation of various synaptic proteins. This, in turn, impacts the structure and function of synapses, allowing for the strengthening or weakening of synaptic connections, essential for encoding and retrieving information in the brain.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 961189109

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lorinna
Grantham, US
★★★★★ 5
BEAUTIFUL QUALITY LOOK!
Color: Rustic Brown, Size: 48 Inch, Style: 2 Pack, Color: Rustic Brown, Size: 48 Inch, Style: 2 Pack
Absolutely Love These!! easy to Install They can Carry a Nice Load!! Super Durable!! Lock Pleasing to the eyes!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
J
Verified Purchase
Jose G. Montijo
Natrona Heights, US
★★★★★ 4
pakaged
When I got them the box had damage and was pleasantly surprised that the shelves weren’t damaged, they were package well. Good quality very light and a nice finish.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
R
Verified Purchase
Robert McDonald
Dallas, US
★★★★★ 5
Very nice at a nice price.
Color: White, Size: 35 Inch, Style: 2 Pack, Color: White, Size: 35 Inch, Style: 2 Pack
Very easy to mount on the wall. Very sturdy with about 10-12 lbs on each shelf. Only took about 15 minutes to hang each one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
C
Verified Purchase
Cherry Lynn
Lowell, US
★★★★★ 5
Cat playground
Color: Black, Size: 35 Inch, Style: 3 Pack, Color: Black, Size: 35 Inch, Style: 3 Pack
Easy to install. Sturdy enough for 2 large rambunctious kitties to play on and look very nice. I was working on a vertical play space for the cats and since these come in many sizes it worked great. I did add grip tape to some.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
A
Verified Purchase
Amazon Customer
Dallas, US
★★★★★ 3
Not the best quality
Color: Rustic Brown, Size: 35 Inch, Style: 2 Pack, Color: Rustic Brown, Size: 35 Inch, Style: 2 Pack
The shelving unit was not as I had expected. It arrived damaged. The damage is on the under side though. They are hollow and not hardwood as I had expected. Save your money if you want something of good quality. These are like 3 pieces of pressed wood glued together. They are space saving and look great in my space. The mounting hardware it comes with was plenty enough to hang these but make sure you hang them in the studs if at all possible. Assembly was simple. It does come with a micro level. Which a kid or pet could accidentally swallow. It’s like pill capsule sized so just be careful when opening the package.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026

recommand products