SKU: 21317087948

Human Neurogranin Protein, hFc tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Neurogranin Protein, hFc tagProduct Specification Species Human Synonyms Ng, RC3, NRGN Accession Q92686 Amino Acid Sequence Protein sequence (Q92686, Met1 Asp78, with C hFc tag) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD Expression System HEK293 Molecular Weight Predicted MW: 34. 5 kDa Observed MW: 43 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag with C hFc tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Synonyms Ng, RC3, NRGN
Accession Q92686
Amino Acid Sequence

Protein sequence (Q92686, Met1-Asp78, with C-hFc tag) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD

Expression System HEK293
Molecular Weight Predicted MW: 34.5 kDa Observed MW: 43 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Neurogranin is a small, acidic protein that is highly expressed in the central nervous system, particularly in neurons. It plays a pivotal role in synaptic plasticity, which is fundamental for learning and memory processes. Located in the postsynaptic density of excitatory synapses, Neurogranin binds to calmodulin. This binding is calcium - dependent. When intracellular calcium levels rise in response to neuronal activity, calcium - calmodulin complexes form. Neurogranin's interaction with calmodulin then modulates the activity of protein kinase C (PKC), an enzyme involved in signal transduction pathways. By regulating PKC, Neurogranin influences the phosphorylation of various synaptic proteins. This, in turn, impacts the structure and function of synapses, allowing for the strengthening or weakening of synaptic connections, essential for encoding and retrieving information in the brain.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 21317087948

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Carnegie, US
★★★★★ 5
Effective
Size: 300 Milliliter
This worked wonders on my car’s performance! After one use, the engine started idling much smoother and the throttle feels more responsive. A very high-quality German-made product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
M
Verified Purchase
Matt
Whiting, US
★★★★★ 5
Great for All Cars but Especially German Cars
Size: 300 Milliliter
I use this in our used VW we bought and it helps keep the carbon build up down with their direct injection feature. I pair it with their oil additive which helps lubricate the rings so they don't stick as much.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
S
Verified Purchase
Sara James
Alexandria, US
★★★★★ 5
Significant Improvement in Performance with Liqui Moly Jectron
Size: 300 Milliliter
I've been using the Liqui Moly 2007 Jectron Gasoline Fuel Injection Cleaner in my vehicle, and I am thoroughly impressed with the results. The 300 ml bottle, though compact, has made a noticeable difference in the performance of my car. After adding the Jectron cleaner to my gasoline tank, I noticed an improvement in the engine's responsiveness and smoothness within just a few drives. The idling has become steadier, and the acceleration feels more robust and refined. It's as if my car has regained a level of vitality that I hadn't realized was missing. The cleaner is incredibly easy to use – simply pouring it into the fuel tank before filling up ensures it mixes well and distributes evenly throughout the fuel system. I appreciate that this product is designed to be compatible with all gasoline engines, making it a versatile choice for different types of vehicles. One of the most significant benefits I've observed is the reduction in start-up problems and engine hesitation. It's clear that the Jectron cleaner effectively cleans the fuel injectors, improving fuel atomization and combustion efficiency. This has not only enhanced the driving experience but also contributed to better fuel economy, which is a fantastic bonus given current fuel prices. The blue color of the liquid and the design of the bottle make it easy to identify and use, ensuring I don't mix it up with other products. Despite being a single 10.14 Fl Oz pack, this cleaner packs a punch, proving that a little goes a long way. In conclusion, the Liqui Moly 2007 Jectron Gasoline Fuel Injection Cleaner has exceeded my expectations. It has revitalized my car's engine, improved fuel efficiency, and provided a smoother, more enjoyable driving experience. I highly recommend this product to anyone looking to enhance their vehicle's performance and maintain the health of their fuel injection system.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2024
P
Verified Purchase
Palmetto Dan
Whiting, US
★★★★★ 5
Great fuel cleaner
Size: 300 Milliliter
Excellent fuel injection cleaner! Works great for keeping injectors clean. Improves engine performance. Easy to use. Makes a noticeable difference. Good value. Highly recommended for regular engine maintenance. Perfect product for anyone caring for their car!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
R
Verified Purchase
Randy W R
Omaha, US
★★★★★ 4
Reputable, reasonably priced fuel additive to clean valves, with handy dispenser. Not all comes out.
Size: 300 Milliliter, Size: 300 Milliliter
Honest review of Liqui Moly 2007 Jectron Gasoline Fuel Injection Cleaner - 300 ml , blue @ $8.68 at time of order. I recently acquired a 2002 Ford Taurus with the 3.0L V6 and DOHC. It only had about 131,000 miles on it, but I noticed it seemed like there would be some intermittent misses in the firing. Other than oil changes, I do not believe that this vehicle was mechanically well maintained. After some research and reading reviews of products, I opted to try some injection cleaner as one step in a treatment regimen. I will endeavor to update this review with results after giving it time to work. Likes: Amazon Prime shipping, returns and refunds within 30 days of receipt. Reputable product. The price point seemed reasonable, especially if it works as advertised (10.1 ounces, single treatment can). Comes with dispensing attachment for easier pouring. Dislikes: The design of the can and pouring mechanism left a small amount of product inside the can of valve cleaner. Even completely inverting the can it wouldn’t come out. Granted, it wasn’t a whole lot, but I paid for all of it, not for some left in the can that wouldn’t even shake out. Sorry if this sounds nitpicky, but it is also a problem for disposal afterwards as it has to sit out and evaporate or put it in the trash with flammable liquid inside. Meh: I have put several miles on since adding this to just over a quarter tank of fuel and have not noticed any improvements. I realize it might take a while longer perhaps. Hopefully this honest review helps someone decide about this product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2023

recommand products