SKU: 95793461963

Rat IgG kappa A, His tag

Sale price$101.25 Regular price$112.50
Save 10%

Pay in installments of $28.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat IgG kappa A, His tagProduct Specification Species Rat Synonyms Ig kappa chain C region, A allele Accession P01836 Amino Acid Sequence Protein sequence (P01836, Ala1 Cys106, with C 10*His) ADAAPTVSIFPPSMEQLTSGGATVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLSLTKVEYERHNLYTCEVVHKTSSSPVVKSFNRNECGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 4 kDa Observed MW: 15, 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Rat
Synonyms Ig kappa chain C region, A allele
Accession P01836
Amino Acid Sequence

Protein sequence (P01836, Ala1-Cys106, with C-10*His) ADAAPTVSIFPPSMEQLTSGGATVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLSLTKVEYERHNLYTCEVVHKTSSSPVVKSFNRNECGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.4 kDa Observed MW: 15, 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a type of antibody. IgG molecules are created and released by plasma B cells. Each IgG antibody has two paratopes. Antibodies are major components of humoral immunity. IgG is the main type of antibody found in blood and extracellular fluid, allowing it to control infection of body tissues. By binding many kinds of pathogens such as viruses, bacteria, and fungi, IgG protects the body from infection. IgG antibodies are large globular proteins made of four peptide chains; two identical γ (gamma) heavy chains of about 50 kDa and two identical light chains of about 25 kDa. light chain (L chain) refers to the small molecular weight peptide chain in immunoglobulin. According to its structure and the antigenicity of the constant region, it is divided into two types: kappa light chain and lambda light chain.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95793461963

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Alyse_Luurtsema
Lexington, US
★★★★★ 5
A favorite for my small destroyers
Color: Monsieur Acorn - Large, Color: Monsieur Acorn - Large
My small destroyer dogs LOVE these toys and are always surprised to find another toy after the first and second violent de-stuffing. Definitely a supervision toy for safety, but my terriers love doing their thing when these come out and they last much longer than I had anticipated. Color, design and value all as described, however I literally do not remember if it did squeak because the squeaker would be the first thing gone
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
C
Verified Purchase
Catherine Burns
Whiting, US
★★★★★ 1
Doesn’t hold up at all.
Color: Hare - Large, Color: Hare - Large
Received this today, and it lasted less than an hour before it had to be taken away to prevent it being eaten.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
N
Verified Purchase
nails44
Birmingham, US
★★★★★ 5
It looks like a Totoro
Color: Hare - Large
Great toy ! Pibble loves it! an it looks just like a Totoro which is huge plus at our house. These are very durable and once de gloved the body will last a very long time if your dog isn’t a big chewer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2025
C
Verified Purchase
Chelsea
Houston, US
★★★★★ 5
Very fun toy at a great price
Color: Monsieur Acorn - Large
My dog (an American Staffordshire Terrier) lovessss to chew and destroy things! We have literally gotten three of these because she loves them so much, and they last, too!! You get the first toy, which my dog rips open. I’m not sure exactly how long it takes for her to destroy it, maybe a few days to a week. Then another little toy (with a sad face lol) is revealed. She highly enjoys this one, as well! Finally, she rips the fabric off that and then a blue, spiky ball is revealed. She lovesss to chew on it and I think the bumps are a nice texture for her mouth. She is quite a strong chewer and the ball lasts a long time!! No toy lasts forever and I have found under dog toys are quite expensive and that’s no guarantee of how long it will actually last. But I am perfectly fine with spending ~$11 every once in a while for these toys because I know she loves them, and they are not immediately destroyed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 25, 2020
M
Verified Purchase
malysway
Lake Worth, US
★★★★★ 5
Would happily purchase again.
Color: Hedgehog
My powerchewer of a dog destroys plushies in 10 minutes and most other 'tough chew' toys don't last more than a day or two - at most. But he loves his hedgehog and hasn't managed to destroy it! Sure, it has a plethora of teeth marks, but it's in one piece and he hasn't managed to bite off any chunks (I was worried about the hedgies nose 😂). It stands up to his teeth and allows him to satisfy his need to gnaw & chew, safely.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026

recommand products