SKU: 26208199669

Brain Natriuretic Peptide Protein, Human

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Brain Natriuretic Peptide Protein, HumanProduct Specification Species Human Synonyms Brain natriuretic peptide 32, Gamma brain natriuretic peptide, B type Natriuretic Peptide, GC B, BNP 32 Accession P16860 Amino Acid Sequence SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Expression System E. coli Molecular Weight 3. 5 kDa (Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 20mM Tris HCl, 200mM NaCl,

Product Specification


Species Human
Synonyms Brain natriuretic peptide 32, Gamma-brain natriuretic peptide, B-type Natriuretic Peptide, GC-B, BNP-32
Accession P16860
Amino Acid Sequence

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Expression System E.coli
Molecular Weight

3.5 kDa (Reducing)

Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris-HCl, 200mM NaCl, pH8.5
Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly by ventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNP precursor gives rise to N-terminal Pro BNP (NT-proBNP) and mature BNP. N-terminal proB-type natriuretic peptide (NT-proBNP), a useful marker of heart failure (HF), is considered to be secreted mainly from the ventricle, increased serum NT-proBNP levels are also encountered in conditions such as atrial fibrillation (AF) and atrial septal defect in patients without HF.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 26208199669

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
CJ
Phoenix, US
★★★★★ 5
Great for both small and larger dogs
Style: Squirrel
My dogs favorite toy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 10, 2026
B
Verified Purchase
B
Charlottesville, US
★★★★★ 1
Didn't even last 60 seconds, literally
It didn't even last 60 seconds. Literally. My dog had it for maybe 30 seconds abd hardly bit it and the whole head unraveled
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 28, 2023
A
Verified Purchase
Anonymous
Port Orchard, US
★★★★★ 5
Does not swallow fur
SO CUTE! Because it is made with strong SHORT furry cloth my Schnauzer can not pull the fur out and swallow it! Great small dog toy!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2019
J
Verified Purchase
Jenny J
Lexington, US
★★★★★ 5
My Puppy Loves this Indestructible Dragon
Size: Large, Color: Pink, Size: Large, Color: Pink
My puppy (8 month old black lab mix) loves, loves, loves her dragon. She has had it for 2 months now. It is one of her favorites and gets daily rough play time. It's her go-to toy for fetch and tug games, as well as just general mouthy play. The squeaker gave out after about 4 weeks, but she would binge squeak for prolonged periods (kind of like chomping on gum) so it was almost a blessing when it went silent. She still chomps on it, but at least now I don't have to hear it. Other than the fact that it's a little grungy and bedraggled from so much loving, it is still in amazing shape. The seams and fur are all still intact. There are no visible holes, rips, or weak spots. I love Chew Guard Technology. This dragon replaced her goDog Iguana (from PetSmart) that developed a tear in the fur after about 4 months of heavy use. (It was superficial, just the outer fur layer and not the innards, but we disposed of it before she could eat more fur.) She can be pretty rough on her toys and I can never predict if any given toy will last minutes or months. The goDog stuffies definitely fall into the "months" category, even with rough daily use. Edit: The dragon lasted about 6 months of intensive, hard play before it developed a small tear in the fur. I patched it a couple times, but once my pup discovers a weak spot, it's the kiss of death for any stuffed item. We had to dispose of the dragon (so sad) to keep her from eating any more of the fur. We replaced the dragon with the goDog Chameleon, which is still going strong. I think we will go back to the dragon for our next toy because it's just so darned cute. We gave the dragon to my niece for her golden retriever puppy who is very chew-happy. That dragon is also doing well. You've just gotta love that chew-guard technology. This is one tough toy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 26, 2015
M
Verified Purchase
Mother of two
Cuba, US
★★★★★ 5
Precious toy for big dogs too
Size: Large, Color: Skinny Green
Not only is this toy cute and fun, but material is thick and durable even for my crazy GSP who is a destruction artist. This is, the favorite toy his go to in the toy box.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026

recommand products