SKU: 92915921261

LYPD3 Fc Chimera Protein, Human

Sale price$211.50 Regular price$235.00
Save 10%

Pay in installments of $58.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 19 - Jul 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LYPD3 Fc Chimera Protein, HumanProduct Specification Species Human Accession O95274 Amino Acid Sequence Leu31 Cys326, with C terminal human IgG Fc

Product Specification


Species Human
Accession O95274
Amino Acid Sequence Leu31-Cys326, with C-terminal human IgG Fc LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGCIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 85-96kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.01EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

LYPD3 (Ly6/PLAUR domain-containing protein 3, C4.4A), first reported in 1998, is a tumorigenic and high-glycosylated cell surface protein that has been proven to be linked with the carcinogenic effects in different solid tumors. The extracellular region of LYPD3 includes two such LU domains (D1 and D2) followed by a C-terminal region, which is rich in serine, threonine and proline. Circumstantial evidence suggests that LYPD3 plays a role in adhesion, migration and invasion similar to that of uPAR. Aberrant expression of LYPD3 plays an oncogenic role in several types of cancer. Expression of the human LYPD3 was observed by RT-PCR and Northern blotting in placental tissue, skin, esophagus and peripheral blood leukocytes, but not in brain, lung, liver, kidney, stomach, colon and lymphoid organs. As demonstrated for malignant melanoma, LYPD3 mRNA expression correlated with tumor progression. The elevated expression of LYPD3 is not only demonstrated to be associated with lung adenocarcinoma carcinogenesis and poor prognosis but also there is evidence that LYPD3 can lead to the initiation and development of cancers and the chemoresistance of metastatic cancers by impacting the and apoptosis of the tumor, which are involved in many important regulatory mechanisms of cancers. This suggests LYPD3 as a potential diagnostic marker. In addition, LYPD3 might serve as a therapeutic target. First preclinical results of a phase I study (NCT02134197) with a LYPD3-directed antibody-drug conjugate (BAY1129980) in non-small cell lung cancer showed a sufficient antitumor efficacy in in vivo models.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 92915921261

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Natrona Heights, US
★★★★★ 5
Nice hoodie
Size: Large, Color: Ash
Very happy with this hoodie. It's exactly what I wanted - something very lightweight that I can just throw on and wear around the house (we keep the temp at 68 in the winter). It appears to be of decent quality and the price was right. I wear a large. That's what I ordered and the fit is perfect.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
V
Verified Purchase
Vaughn Francis
Belleville, US
★★★★★ 3
Hanes Pullover Hoodie (Red)
Size: Large, Color: Deep Red
​Pros: ​The red color is vibrant and looks great out of the box. ​Initial fit is decent. ​Cons: ​Excessive Shedding: The "fuzz" and inner lining fibers get absolutely everywhere. It sticks to your undershirt, your hair, and even the furniture. It’s a constant annoyance that doesn't seem to stop even after the first wear. ​Color Bleeding: The dye runs significantly. If you aren't extremely careful in the wash, it will ruin anything lighter than it, and you'll notice the vibrancy of the red fading faster than expected. ​Low Durability: Between the shedding and the dye issues, the quality just isn't there for long-term use. ​Final Verdict: I’d give this a 3/5 at best. While it’s an affordable basic, the mess it leaves behind and the hassle of the dye running make it more of a headache than it’s worth. I’d recommend looking for something with a higher-quality fleece lining that won't leave you covered in red lint.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
A
Verified Purchase
Amy
Bozeman, US
★★★★★ 5
Nice shoes
Size: 13 Wide Big Kid, Color: Purple/Turq
Absolutely love the colors on these shoes. My daughter loves them and says they are comfortable! Would buy them again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2026
S
Verified Purchase
Stephanie J.
Lake Worth, US
★★★★★ 5
Comfortable!
Size: 12.5 Big Kid, Color: Purple/Turq
My daughter loves these. She’s5. We got the size 12.5 and they fit her well.. a little space between her toes and the tip of the shoe but just the right amount. She says they are comfortable and good for her PE class and playing outside. We got the blue and then I ordered the black cause she loved them so much. They were on a great sale too!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 29, 2025
A
Verified Purchase
Amazon Customer
Massapequa, US
★★★★★ 5
Great kids sneakers
Size: 4 Big Kid, Color: Grey/Green
My kid loves the sneakers they are holding up well and the fit is true to size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026

recommand products