SKU: 63325380407

Her3 His Tag Protein, Rhesus macaque

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 19 - Jul 24

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Her3 His Tag Protein, Rhesus macaqueProduct Specification Species Rhesus macaque Synonyms Her3, FERLK, LCCS2, VSCN1 Accession G7N7B1 Amino Acid Sequence Ser20 His641, with C terminal 10* His Tag

Product Specification


Species Rhesus macaque
Synonyms Her3, FERLK, LCCS2, VSCN1
Accession G7N7B1
Amino Acid Sequence

Ser20-His641, with C-terminal 10* His Tag SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWKDIVRDQDAEIVVKDNGRSCPLCHEVCKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMYNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

80-94kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Zhang N. et al. (2016) HER3/ErbB3, an emerging cancer therapeutic target. Acta Biochim Biophys Sin. 48(1): 39-48.

Background

HER3 is a member of the HER (EGFR/ErbB) receptor family consisting of four closely related type 1 transmembrane receptors (EGFR, HER2, HER3, and HER4). HER receptors are part of a complex signaling network intertwined with the Ras/Raf/MAPK, PI3K/AKT, JAK/STAT, and PKC signaling pathways. Aberrant activation of the HER receptors and downstream signaling molecules tips the balance on cellular events, leading to various types of cancers. The HER3 protein is expressed in several types of tumors. That fact, together with the role of HER3 in promoting cell proliferation, implicate that targeting HER3 may have therapeutic relevance. Furthermore, expression and activation of HER3 has been linked to resistance to drugs that target other HER receptors such as agents that act on EGFR or HER2.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 63325380407

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
San Leandro, US
★★★★★ 5
Nice hoodie
Size: Large, Color: Ash
Very happy with this hoodie. It's exactly what I wanted - something very lightweight that I can just throw on and wear around the house (we keep the temp at 68 in the winter). It appears to be of decent quality and the price was right. I wear a large. That's what I ordered and the fit is perfect.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
V
Verified Purchase
Vaughn Francis
Natrona Heights, US
★★★★★ 3
Hanes Pullover Hoodie (Red)
Size: Large, Color: Deep Red
​Pros: ​The red color is vibrant and looks great out of the box. ​Initial fit is decent. ​Cons: ​Excessive Shedding: The "fuzz" and inner lining fibers get absolutely everywhere. It sticks to your undershirt, your hair, and even the furniture. It’s a constant annoyance that doesn't seem to stop even after the first wear. ​Color Bleeding: The dye runs significantly. If you aren't extremely careful in the wash, it will ruin anything lighter than it, and you'll notice the vibrancy of the red fading faster than expected. ​Low Durability: Between the shedding and the dye issues, the quality just isn't there for long-term use. ​Final Verdict: I’d give this a 3/5 at best. While it’s an affordable basic, the mess it leaves behind and the hassle of the dye running make it more of a headache than it’s worth. I’d recommend looking for something with a higher-quality fleece lining that won't leave you covered in red lint.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
A
Verified Purchase
Amy
Lowell, US
★★★★★ 5
Nice shoes
Size: 13 Wide Big Kid, Color: Purple/Turq
Absolutely love the colors on these shoes. My daughter loves them and says they are comfortable! Would buy them again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2026
S
Verified Purchase
Stephanie J.
Draper, US
★★★★★ 5
Comfortable!
Size: 12.5 Big Kid, Color: Purple/Turq
My daughter loves these. She’s5. We got the size 12.5 and they fit her well.. a little space between her toes and the tip of the shoe but just the right amount. She says they are comfortable and good for her PE class and playing outside. We got the blue and then I ordered the black cause she loved them so much. They were on a great sale too!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 29, 2025
A
Verified Purchase
Amazon Customer
Whiting, US
★★★★★ 5
Great kids sneakers
Size: 4 Big Kid, Color: Grey/Green
My kid loves the sneakers they are holding up well and the fit is true to size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026

recommand products