SKU: 91824610714

CD7 Ligand/SECTM1 His Tag Protein, Human

Sale price$226.80 Regular price$252.00
Save 10%

Pay in installments of $63.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD7 Ligand/SECTM1 His Tag Protein, HumanProduct Specification Species Human Antigen CD7 Ligand Synonyms CD7 Ligand, SECTM1, K12 Accession Q8WVN6 Amino Acid Sequence Gln29 Gly145, with C terminal 8*His QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGGGGSHHHHHHHH Expression System HEK293 Molecular Weight 17 22kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Antigen CD7 Ligand
Synonyms CD7 Ligand, SECTM1, K12
Accession Q8WVN6
Amino Acid Sequence

Gln29-Gly145, with C-terminal 8*His QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 17-22kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Lyman S D. et al. (2000) Identification of CD7 as a cognate of the human K12 (SECTM1) protein. J Biol Chem. 275(5): 3431-3437.

2、Lam G K. et al. (2005) Expression of the CD7 ligand K-12 in human thymic epithelial cells: regulation by IFN-gamma. J Clin Immunol. 25(1): 41-49.

Background

SECTM1 (secreted and transmembrane 1), also called K12, is either found as an approximately 27 kDa intracellular type I transmembrane protein that shows a perinuclear, Golgi‑like staining pattern, or as a 20 kDa soluble, secreted form. SECTM1 is expressed on thymic epithelial and fibroblast cells, breast cancer and leukemia cell lines, and neutrophils but not in peripheral lymphocytes. SECTM1 is expressed on cytomembrane, which is identified as a CD7 ligand.CD7 is expressed in T and natural killer (NK) cells, which could be activated by its ligand SECTM1, thus promoting the proliferation of T and NK cells. SECTM1 strongly costimulates CD4 and CD8 T cell proliferation and induces IFN-γ production, likely via a CD7-dependent mechanism. In addition, SECTM1 synergizes with suboptimal anti-CD28 to strongly augment T cell functions. A robust induction of IL-2 production when SECTM1 and anti-CD28 signals were present with TCR ligation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 91824610714

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Adrian
Cuba, US
★★★★★ 5
A Must-Have for Sensitive Skin
Size: 5 Fl Oz (Pack of 1)
recently tried La Roche-Posay sunscreen and I’m really impressed! 🌞 The texture is lightweight, non-greasy, and absorbs quickly without leaving a white cast, which is a big plus for daily wear. It feels gentle on my skin and doesn’t clog pores, making it perfect for sensitive or acne-prone skin. I also love that it provides strong, broad-spectrum protection while still feeling breathable. Overall, it’s become my go-to sunscreen—I actually enjoy applying it every morning because it feels more like skincare than sunscreen. Definitely worth it! I would be honored if you would consider me to receive a PR package. I’d love the opportunity to try more of your products and create authentic content that highlights the benefits of La Roche-Posay skincare. Thank you so much for your time and consideration! Warm regards, Andrea Mohanlall
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 4, 2025
B
Verified Purchase
Bywater Mike
Charlottesville, US
★★★★★ 5
Goes on smooth with no white cast.
Size: 3 Fl Oz (Pack of 1)
This is excellent and disappears on the skin. Smooth as silk.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
C
Verified Purchase
Carmen Suárez
Lexington, US
★★★★★ 4
It feels very good on the skin.
Size: 3 Fl Oz (Pack of 1)
I’ve been using this sunscreen for about a week now, and honestly, I’ve liked it even more than I expected. The skin on my face feels much softer and healthier, and one thing I’ve definitely noticed is that my dark circles are gradually looking a bit lighter and less tired. I love it because it doesn’t feel heavy, absorbs quickly, and doesn’t leave a greasy residue. I also like that it works well under makeup or just on its own for everyday use. For now, I’m giving it 4 stars because I haven’t been using it for very long yet and want to see more results, but so far, I definitely feel a difference in my skin. If I continue to see more positive changes, I’ll come back to update my review.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
D
Verified Purchase
Diane P
Charlottesville, US
★★★★★ 5
Blends nicely, is not greasy.
Size: 5 Fl Oz (Pack of 1)
Light, blends nicely into skin. Does a good job of blocking the sun. I will buy it again before the summer is over.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
A
Verified Purchase
Aj
Lexington, US
★★★★★ 5
Feels like nothing!
Size: 3 Fl Oz (Pack of 1)
Fantastic! I never write reviews but this is incredible. Just as advertised it dries quickly, doesn’t feel oily and doesn’t leave marks. And the coverage is no joke in this AZ sun! Held up during Memorial Day weekend at the pool all day. Excellent all around!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026

recommand products