Pay in installments of $72.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 1 - Sep 6
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
MOG His Tag Protein, MouseProduct Specification Species Mouse Antigen MOG Synonyms BTN6, BTNL11, MOGIG2, NRCLP7, Myelin oligodendrocyte glycoprotein Accession Q61885 Amino Acid Sequence Gly29 Gly153, with C terminal 8*His GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGGGGSHHHHHHHH Expression System HEK293 Molecular Weight 19 22kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation
Product Specification
| Species | Mouse |
| Antigen | MOG |
| Synonyms | BTN6, BTNL11, MOGIG2, NRCLP7, Myelin oligodendrocyte glycoprotein |
| Accession | Q61885 |
| Amino Acid Sequence |
Gly29-Gly153, with C-terminal 8*His GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 19-22kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Reindl, M. et al. (2013) Nat. Rev.Neurol. 9:455. |
Background
Myelin oligodendrocyte glycoprotein (MOG) is a transmembrane protein belonging to immunoglobulin superfamily. Mouse MOG is synthesized with a 28 amino acid (aa) signal sequence, a 128 aa extracellular domain (ECD) containing an Ig-like domain, a 21 aa transmembrane domain, and a 69 aa cytosolic fragment featuring a hydrophobic domain that associates with the cytoplasmic face of the plasma membrane. MOG is expressed exclusively by oligodendrocytes in the central nervous system (CNS) and is localized to the outer layer of the myelin sheath as well as in the oligodendrocyte plasma membrane. This makes MOG a potential target of cellular and humoral immune responses in inflammatory demyelinating diseases.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy