SKU: 59343087061

CD63 His Tag Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD63 His Tag Protein, HumanProduct Specification Species Human Antigen CD63 Synonyms LAMP 3, MLA1, TSPAN30 Accession P08962 Amino Acid Sequence Ala103 Val203, with C terminal 8*His AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGS Expression System HEK293 Molecular Weight 20 31kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7.

Product Specification


Species Human
Antigen CD63
Synonyms LAMP-3, MLA1, TSPAN30
Accession P08962
Amino Acid Sequence

Ala103-Val203, with C-terminal 8*His AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGS

Expression System HEK293
Molecular Weight

20-31kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Sònia Tugues. Tetraspanin CD63 Promotes Vascular Endothelial Growth Factor Receptor 2-β1 Integrin Complex Formation, Thereby Regulating Activation and Downstream Signaling in Endothelial Cells in Vitro and in Vivo. 2. J Biol Chem 2013 Jun28;288(26):19060-71. Epub 2013 Apr 30.

Background

CD63 is a member of the transmembrane-4 glycoprotein superfamily, known as tetraspanins. The tetraspanins contain four transmembrane domains, two extracellular loops flanked by short intracellular N and C termini, and a highly conserved sequence motif within the larger extracellular domain. Tetraspanins interact among themselves and with other transmembrane proteins to form membrane domains denoted tetraspanin-enriched microdomains (TEMs). At least in part through the TEMs, tetraspanins regulate a variety of cellular processes including cell fusion, intracellular trafficking, cell adhesion, motility, invasion, and cell differentiation. CD63 is among the most highly expressed tetraspanins in endothelial cells (ECs). Still, the role of CD63 in endothelial biology and angiogenesis remains to be addressed. We show that CD63 is co-localized with the type I integral lysosomal membrane protein (LAMP-1) but also present on the EC surface. By silencing CD63 expression in primary ECs, we demonstrate that CD63 associated with both β1 integrin and VEGFR2 in the plasma membrane and was required for VEGFR2-β1 integrin complex formation. Loss of CD63 expression disrupted downstream signaling path ways both in endothelial cells in culture and in intact tissues. As a consequence, CD63-deficient ECs failed to engage in sprouting angiogenesis and organize into tube structures.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 59343087061

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Evan
Draper, US
★★★★★ 5
Great classic timepiece
Color: Black/Digital Gray/Silver-Tone, Color: Black/Digital Gray/Silver-Tone
I’ve been using the Timex Men’s Ironman Triathlon Classic 30 (38mm) for a while now, and it’s easily one of the most dependable watches I’ve owned. The design is simple but functional — lightweight, comfortable, and perfect for workouts, outdoor activities, or just daily wear. The Indiglo backlight is super bright and makes it easy to read in the dark, and the buttons are responsive without feeling flimsy. The stopwatch and countdown timer features are straightforward and accurate, which I really appreciate for timing workouts. I also like that it’s water-resistant, so I never have to worry about it in the rain or while swimming. The 38mm size is just right — not too bulky, but still sporty and easy to read. The battery life is excellent, and the Timex durability definitely shows; this watch can take a beating and still look good. If you want something rugged, affordable, and practical, the Ironman Classic 30 is a solid choice. It’s a no-nonsense watch that does exactly what it’s supposed to — and does it well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 2, 2025
K
Verified Purchase
kone
West Palm Beach, US
★★★★★ 5
Lightweight, Options, and Ease of Use Make this a Great Watch
Color: Black
I have purchased many Timex watches over the years and I am entirely satisfied with this watch. I always buy the sports watch, as I swim and do triathlons. Things I like about the watch: *Setting the watch is easy and the instructions are clear (although the printed instructions are very small!) * The watch is not too big. So many watches have too many features and they are large, bulky, and heavy. This watch is sleek, has a low profile, and has a size that is ideal for average needs. * The numbers are big enough to see easily at a glance. * There are enough useful options, and this watch is not overloaded with too many options. Too many options are confusing to me. I like the simplicity of this watch and the ease of use of the options it has. * I like the plastic watch band. I have tried the velcro strap bands and they wear out after a year or so of use. The plastic band will eventually break, but is fairly easy to replace. * I like the price. At less than 35 dollars I have everything I need in a watch. * I like and use frequently the Indiglo feature. I have even used Indiglo to find my way to the bathroom at night from bed! The light on the dial is bright enough to make your way through the dark for a short trip! Things I don't like: There is not much I don't like about this Timex watch. I suppose my biggest complaint about this watch and any Timex watch is the difficulty in changing the battery. The battery will eventually need replacement, and of course one has to take off the back of the watch to replace the battery. This is tricky and takes a steady hand. I wish Timex would make the battery more accessible so changing the battery would be as easy as sliding one in or out of a hinged door (like on a hearing aid). Obviously, there is much more to like about this watch than not like. I do recommend it for a good sport watch. It will withstand chlorine pools, lake water, rainfall, high and low temperatures, but be careful not to scratch the dial window! I scratched the main window crystal and ruined my last watch. Avoid spraying any kind of bug repellant on the window as well, as this can mar (dull) the surface. For me, this watch meets all my needs and I give it a 5-star rating. My needs are faily simple. There are certainly other watches that offer more features, but to me, the added features add complexity and are not worth the added bother. The price is good. The watch is good quality. This is a good buy. Jim "Konedog" Koenig
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2008
E
Verified Purchase
EoE
Dallas, US
★★★★★ 4
Great watch; but why the triangle screws?
Color: Black/Digital Gray/Silver-Tone
I have been using these watches for many years with very good luck, and would normally give them 5 stars. They are comfortable, waterproof, durable, and have an alarm and a countdown timer. (The waterproof and countdown timer - that can be set to repeat - make them good for sailboat racing, and these are much cheaper than sailing watches. ) But at some point before the watch breaks, the battery will die. It is not hard to replace the battery. Except now the watch comes with triangle head screws holding the back on, rather than the regular phillips head screws they used to have. Why? Is it that important to keep people from opening up their watch? Making things harder to fix is a step in the wrong direction. Knocking off one star for that.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 28, 2025
L
Verified Purchase
L Chance Correll
Charlottesville, US
★★★★★ 5
Still the champ.
Color: Black/Negative Digital/Gray, Color: Black/Negative Digital/Gray
I absolutely LOVE my Casio GBA800 that I have bully bars on, so she's quite huge. Analog with Bluetooth, pretty cool. If I ever remember to use such things. I have a phone and laptop on me usually, why do I need to play with my watch? I want to tell time, that's it. Comes along a good sale for an Ironman, and I used to be a complete fanatic for only Ironman for a real person's needs. Why not, I've been fighting the Casio all day with my coat cuff, let's get something a bit slimmer for when it's coat season. See if they're still great. Yup! Sure is. It's been probably 25 years ago last time I wore this style of Timex, and can you believe the button setup and beeps are all still the same as way back when! And somehow, my subconscious remembers the button presses. Wild. This thing is light as a feather, and I got the inverse LCD for fun, which is cool as all get out, but takes some getting used to. The Indiglo sure looks awesome, though, and she's like Knight Rider down there. Stealth. The display is big, and easy even for my old eyes, the band is supremely comfortable, and there's a strap catch that actually works correctly! With no Bluetooth, battery life should be outstanding - always used to be. Back when watch batteries were like $12 each. There goes my allowance! Lol. I'm very impressed by this timepiece. I really didn't mean to order order it, but, oh well. I love it as much as my Casio. Affordable tough watches rock!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2025
L
Verified Purchase
Lenny Duncan
Phoenix, US
★★★★★ 5
The colour is cool
Color: Black/Digital Black/Black
Cool stuff
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026

recommand products