SKU: 91222558796

Human Cathepsin D Protein, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Cathepsin D Protein, His tagProduct Specification Species Human Synonyms Cathepsin D, CTSD, CPSD Accession P07339 Amino Acid Sequence Protein sequence (P07339, Leu21 Leu412, with C His tag)

Product Specification


Species Human
Synonyms Cathepsin D, CTSD, CPSD
Accession P07339
Amino Acid Sequence

Protein sequence (P07339, Leu21-Leu412, with C-His tag) LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL

Expression System HEK293
Molecular Weight Predicted MW: 44.3 kDa Observed MW: 54 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 20mM Citrate Buffer, 150mM NaCl, pH6.0.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Cathepsin D is a protein that in humans is encoded by the CTSD gene. This gene encodes a lysosomal aspartyl protease composed of a protein dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. Cathepsin D is an aspartic endo-protease that is ubiquitously distributed in lysosomes. The main function of cathepsin D is to degrade proteins and activate precursors of bioactive proteins in pre-lysosomal compartments. This proteinase, which is a member of the peptidase A1 family, has a specificity similar to but narrower than that of pepsin A. Mutations in this gene are involved in the pathogenesis of several diseases, including breast cancer and possibly Alzheimer disease.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 91222558796

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
deborah
New York, US
★★★★★ 4
Ok
Color: Dark Teal, Size: King
Looks pretty but not on my bed. It constantly looks messy. I don’t like the lack of neatness.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026
M
Verified Purchase
Milagros Quinones
Pawtucket, US
★★★★★ 5
Couple Win
Color: Spa Blue, Size: King
The Amazon Basics Lightweight Soft King Size Comforter has been a wonderful purchase for our home! The comforter is incredibly soft, comes in beautiful colors, and is the perfect lightweight option for year-round use. My husband and I have very different sleep preferences—I tend to run hot while he’s always cold—but this comforter somehow works perfectly for both of us. It’s breathable enough that I stay comfortable while still providing enough warmth for him. We finally started sharing the same blanket again, which is a win in itself! Highly recommend for couples with different temperature preferences. 🛏️💕✨
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
K
Verified Purchase
Kathleen Cox
Carnegie, US
★★★★★ 5
High quality in every way!
Color: Blush, Size: Full/Queen
Very soft and beautiful! Nothing skimpy about this one! Very pleased.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
T
Verified Purchase
Tara Miller
Draper, US
★★★★★ 5
Light Weight but Not Hot
Color: Dark Grey, Size: King
Ok... I absolutely love this comforter. In fact, I use it on three different beds. The colors are perfect. The material is soft. It's extremely light weight, but it keeps you warm in the winter and does not overheat you in the summer. I have this in King and Queen, and the sizing has been good for both. I have thrown it in my washing machine multiple times, and it holds up well. Great quality, low price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 3, 2025
T
Verified Purchase
TheMrs
Natrona Heights, US
★★★★★ 3
Navy is pretty, but doesn’t feel like a great quality set.
Color: Navy Blue, Size: King
I purchased the Navy. The color is great and the pleated pattern is a nice touch. My daughter has the white and it’s very soft. The navy is not, though. So that was disappointing. It’s also not breathable. It’s not thick, but just not breathable. I actually get pretty warm at night with this one when I don’t normally with any other blankets. It also seems on the small side. We have a king and always buy king, this just feels a little smaller. Doesn’t feel high quality. I would not buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 11, 2025

recommand products