SKU: 90187707091

Canis lupus familiaris CD64, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Canis lupus familiaris CD64, His tagProduct Specification Species Canis lupus familiaris Synonyms High affinity IgG Fc gamma receptor 1, FcgammaRI Accession Q7YQJ5 Amino Acid Sequence Protein sequence (Q7YQJ5, Gln16 Pro288, with C 10*His)

Product Specification


Species Canis lupus familiaris
Synonyms High affinity IgG Fc gamma receptor 1, FcgammaRI
Accession Q7YQJ5
Amino Acid Sequence

Protein sequence (Q7YQJ5, Gln16-Pro288, with C-10*His) QTDPVKAVITLQPPWVSVFQEESVTLWCEGPHLPGDSSTQWFLNGTATQTLTPRYRIAAASVNDNGEYRCQTGLSVLSDPIQLGIHRDWLILQVSGRVFTEGEPLTLRCHGWNNKLVYNVLFYQNGTVLKFSPQNSEFTILKTTLHHNGIYHCSAMGKHRYESAGVSITIKELFPAPVLKASLSSPILEGHVVNLSCETKLLLQRPGLQLYFSFYMGSKTLLSRNTSSEYQILTAKKEDSGLYWCEATTEDGNVVKRSPELELQVVGPQTLTPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 32.2 kDaObserved MW: 33, 40, 45 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD64 (Cluster of Differentiation 64) is a type of integral membrane glycoprotein known as an Fc receptor that binds monomeric IgG-type antibodies with high affinity. It is more commonly known as Fc-gamma receptor 1 (FcγRI). After binding IgG, CD64 interacts with an accessory chain known as the common γ chain (γ chain), which possesses an ITAM motif that is necessary for triggering cellular activation. Structurally CD64 is composed of a signal peptide that allows its transport to the surface of a cell, three extracellular immunoglobulin domains of the C2-type that it uses to bind antibody, a hydrophobic transmembrane domain, and a short cytoplasmic tail. CD64 is constitutively found on only macrophages and monocytes, but treatment of polymorphonuclear leukocytes with cytokines like IFNγ and G-CSF can induce CD64 expression on these cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90187707091

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
KillerGhostWriter
Dallas, US
★★★★★ 5
Great Toy Bundle
Color: 9 Pack (No-stuffed Fox)
My puppy loves these so much that I purchased a second set! The toys keep him engaged, are very cute and soft, and so far have withstood the wrath of a slightly psychotic furchild! Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
G
Verified Purchase
GooGooDolphins
Boise, US
★★★★★ 5
My puppy loves this set
Color: 9 Pack (No-stuffed Fox)
It’s been 15 years since I had a puppy so after I adopted a 9 week old puppy, then I realized I had no toys for her! I wanted a variety at a reasonable price. And fast too! This arrived the next day and she immediately started playing with everything. I think her favorite is the fox but she loves them all. The first time she heard the avocado squeak was priceless. She also loves the rope toys but they shred so I limit her time alone with them. These probably won’t last a long time but they were a good price for a lot of variety of items. She is happy so I’m happy. Thanks
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
M
Verified Purchase
Melissa Routheaux
West Palm Beach, US
★★★★★ 3
Poop bag and treat dispenser questionable
Color: 9 Pack (No-stuffed Fox)
This is a hard one. The toys seem great. The whole box smells of the poop bags and I don't think they should be a part of the purchase. The bigger issue i see is the treat ball seems to have a weird plastic coating on it. Almost like a thin clear coat that gives is a peeling feeling and I don't think it is safe for the puppy. Excited to see how she likes the other toys though.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
T
Verified Purchase
Tollie
Natrona Heights, US
★★★★★ 5
Great durable toys for baby/small dogs
Color: 9 Pack (No-stuffed Fox)
These were perfect for our 8 week old dachshund. She loves every one of the toys.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
L
Verified Purchase
Laurica Zio
Charlottesville, US
★★★★★ 5
Wash first
Color: 25 Pack (Value-Toys)
These are excellent and very well made for a 1 and 1/2 lb Chihuahua girl. I don't know how much they would hold up for a bigger dog but they're perfect for a little one. We always wash all of her toys first and I didn't notice that there were garbage bags in there. Which ended up being a good thing because they were scented. Washing help to get most of the scent off and it took the scent off of the toys. She hates the scent. Me too. It was nice to have the doggy bags though and we would prefer them not scented. We didn't dry the toys and we let them air dry which is a good thing cuz it might have ruin the bags. The bags are a little small and short compared to the normal bags that you buy but overall this is a really good value and she loves all of the teethers and ropes very much. Very well made. Nothing has fallen apart and she has chewed it a lot. I don't know how it would be for a bigger dog but for one and a half pound puppy Chihuahua it's perfect
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 13, 2026

recommand products