SKU: 75873897989

Mouse IgG kappa, His tag

Sale price$117.00 Regular price$130.00
Save 10%

Pay in installments of $32.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IgG kappa, His tagProduct Specification Species Mouse Synonyms Ig kappa chain C region MOPC 21 Accession P01837 Amino Acid Sequence Protein sequence (P01837, Arg1 Cys107, with C 10*His) RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 6 kDa Observed MW: 13. 6 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Mouse
Synonyms Ig kappa chain C region MOPC 21
Accession P01837
Amino Acid Sequence

Protein sequence (P01837, Arg1-Cys107, with C-10*His) RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.6 kDa Observed MW: 13.6 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin kappa constant, also known as IGKC, is a gene that encodes the constant domain of kappa-type light chains for antibodies. The immunoglobulin light chain is the small polypeptide subunit of an antibody (immunoglobulin). A typical antibody is composed of two immunoglobulin (Ig) heavy chains and two Ig light chains. kappa (κ) chain is one of the two types of light chain in humans. A free light chains test measures the amount of lambda and kappa free light chains in the blood. If the amount of free light chains is higher or lower than normal, it can mean you have a disorder of the plasma cells. These include multiple myeloma, a cancer of plasma cells, and amyloidosis, a condition that causes a dangerous buildup of proteins in different organs and tissues.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 75873897989

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Benji Gulf Coast
Battle Creek, US
★★★★★ 3
Great for a costume, but not for every day
Color: White, Size: Medium
I'm not sure what I was really expecting, but these pants made me feel like I was in the song zoot suit riot and/or Dick Tracy was trying to find me. They honestly just feel very costume-ish as opposed to being something dressy. I couldn't see myself wearing these to a job interview, which is kind of my standard for what qualifies as "dress clothes." However, they do fit quite well in the waist the and down the leg. I have a wide variety of clothing options, but I even find it difficult to pair anything with these pants.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 26, 2025
C
Verified Purchase
Clark
Grantham, US
★★★★★ 5
The pinstripes
Color: Black, Size: Medium
Love the style!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 11, 2025
J
JB in NYC
Alexandria, US
★★★★★ 5
Lightweight Fabric with a Bit of Stretch
Color: Black, Size: Medium, Color: Black, Size: Medium
I'm a fan of any fabric that has a small percentage of Spandex in the blend -- like these pants. (Along with mostly polyester and viscose.) It's not noticeably stretchy but the comfort is there. The fabric is very light and smooth -- and the stripes make a nice design statement. (They're giving me "gangster" vibes. Ha!) I have a 32" waist and the Medium fits me perfectly (with a little room to spare). I do have to hem the bottoms since I'm on the short side, but they taper nicely down the leg. There's an "adjustable waist" mentioned in the headline description, but I don't see anything resembling an adjustable waist on the pants. Just a hook and button closure. (Maybe I'm missing something?) I'm happy to add these to my wardrobe.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2025
J
Verified Purchase
Jeff
Waukegan, US
★★★★★ 5
Second Best Bifold I’ve Owned
Color: Black
I’ve gone through a lot of wallets over the years (cheap ones, expensive ones, slim cardholders, you name it), and this Timberland bifold with the attached flip pocket is easily the best all-around wallet I’ve ever carried. The leather is excellent: full-grain, soft right out of the box, and it’s aged beautifully in just a few months with a rich patina that actually looks better with every scratch and scuff. Build quality is top-notch: tight, even stitching, no loose threads, and the edges are finished cleanly. Four months of daily front-pocket carry and it still looks practically new. Layout is perfect for me. Six card slots plus the two slip pockets behind them handle everything I need (10 cards + a few folded bills) without getting bulky. The attached flip ID window is a game-changer; I keep my driver’s license and work badge there and can show either in seconds without opening the wallet. Cash fits easily in the full-length bill compartment. It’s genuinely slim for a traditional leather bifold, sits comfortably in both front and back pockets, and never feels like a brick. The embossed Timberland logo is subtle and classy. At this point I can’t imagine switching to anything else. It’s durable, functional, looks sharp, and was a fraction of the price of some “luxury” wallets that didn’t last half as long. If you want a classic leather bifold that actually delivers, this is it. 100% recommended; already planning to buy another as a backup.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 6, 2025
V
Verified Purchase
Viral Fixes Daily
Dallas, US
★★★★★ 5
Rugged Timberland Quality—The Best Bifold for "Double ID" Needs
Color: Black (Sportz)
Design & Capacity: I’ve been using this wallet for two weeks, and it’s a powerhouse for organization. The attached flip pocket is a game-changer for me because I have to carry both a driver's license and a work security badge. The two ID windows let me show both without digging through card slots. Genuine Leather: Looks and smells premium; will likely weather nicely with age. The Slimness Factor: Timberland calls this a "slimfold," and while it is thinner than a traditional trifold, the flip-out pocket does add some depth. With 6 cards and 5 bills, it measures about 0.75 inches thick. It fits comfortably in my back pocket, but it might be a bit much for a front-pocket-only user.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 5, 2026

recommand products