SKU: 88912597318

GPA33 His Tag Protein, Mouse

Sale price$184.50 Regular price$205.00
Save 10%

Pay in installments of $51.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GPA33 His Tag Protein, MouseProduct Specification Species Mouse Antigen GPA33 Synonyms Cell surface A33 antigen, Glycoprotein A33, GPA33, Glycoprotein A33 (Transmembrane), Transmembrane Glycoprotein A33, A33 Accession Q9JKA5 Amino Acid Sequence Leu22 Ile235, with C terminal 8*His

Product Specification


Species Mouse
Antigen GPA33
Synonyms Cell surface A33 antigen, Glycoprotein A33, GPA33, Glycoprotein A33 (Transmembrane), Transmembrane Glycoprotein A33, A33
Accession Q9JKA5
Amino Acid Sequence

Leu22-Ile235, with C-terminal 8*His LTVETTQDILRAARGRSVTLPCTYNTYVSDREGFIQWDKLLRSQTERVVTWNFVTKKYIYGNRYENRVRVSNDAELSNASITIDQLTMDDNGTYECSVSLMSDQDVNAKSRVRLLVLVPPSKPDCSIQGEMVIGNNIQLTCHSAEGSPSPQYSWKSYNAQNQQRPLTQPVSGEPLLLKNISTETAGYYICTSSNDVGIESCNITVAPRPPSMNIGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 33-40kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Heath, J. K. , White, S. J. , Johnstone, C. N. , Catimel, B. , Simpson, R. J. , Moritz, R. L. , Tu, G. F. , et al. The human A33 antigen is a transmembrane glycoprotein and a novel member of the immunoglobulin superfamily. Proc. Natl. Acad. Sci. U. S. A. 1997. 94: 469-474.

Background

Glycoprotein A33 (GPA33) is also known as Cell surface A33 antigen, is a single-pass type I membrane protein which is expressed in normal gastrointestinal epithelium and in 95% of colon cancers.GPA33 has high homology with CD2 and contains a V‐type Ig‐like domain at the N terminus. It is also related to proteins that have inhibitory roles in T cell activation, such as CD276 (B7‐H3) and VSIG4 and several cell adhesion molecules, such as CEACAM, ICAM, and NCAM (3D‐Protein BLAST, NCBI). Although its molecular function is not known, GPA33 has been associated with immune dysregulation. GPA33 may play a role in cell-cell recognition and signaling.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 88912597318

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Terrisa Weber
San Leandro, US
★★★★★ 5
It’s a maybe book
Format: Paperback
The first few chapters was interesting but as I got further in it I felt like I didn’t need to read or want to read anymore
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
A
Verified Purchase
avid reader U.S.
Pawtucket, US
★★★★★ 4
Thorough and careful research but I do disagree on some points
Format: Paperback
Review for 'When Giants Were Upon the Earth". As a Christian Bible reader of many years, I was not sure what I was getting myself into by buying and reading this book. ( I do have other books that are not part of the Bible such as Mr. Godawa mentions for reference.) Mr. Godawa has made careful and thorough research on the subject of the Nephilim which is only briefly mentioned in the Bible. He has broadened my understanding of little known facts about the giants and the pagan beliefs of other cultures. I was pleasantly surprised and pleased that a Hollywood screenwriter would do justice to the teachings of God. I do disagree with him about his ideas about satan - I believe he is an individual spirit being and the leader of the other angels that revolted in Heaven. In the New Testament we note that he is ruler of this world John 12:31, he transforms himself into an angel of light II Cor 11:14 and he is also a roaring lion 1 Peter 5:8. I am not totally finished with this book yet but I am hoping that there is information on Nimrod. I would recommend this book for Christian readers who want Bible information 'fleshed out' and explained and about the sons of God, the Nephilim etc.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 21, 2017
M
Verified Purchase
Mr Jay
Dallas, US
★★★★★ 5
Me
Format: Paperback
Great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
W
Verified Purchase
WisdomQuest
Dallas, US
★★★★★ 5
What they Didn't Teach You in Sunday School
Format: Paperback
Often when reading through the Bible, whether one does so for religious reasons or not, we miss details in the background. Or we do not take into consideration cultural context while interpreting passages. Sometimes, due to difficulties in translating ancient languages into modern ones, some things are literally lost in translation. In this volume, where Godawa collects material he has previously published into one volume, he examines many of these issues. In particular, he focuses on topics that have long mystified people and been the subject of much conjecture and fictionalization: Nephilim, Watchers and giants. He also takes a close look at verses that may have had supernatural elements inadvertently scrubbed: The strange ariel creatures in 2 Samuel 23:20 translated instead into men, or the demons and goblins of Isaiah 13:21-22 written off as wild animals, etc. Clues to a different ancient world than usually supposed? The only misstep is his adherence to the John Walton ANE interpretation. This is based on superficial interpretation, and worse history (e.g. the whole ANE "dome" interpretation of creation is largely mythical). Walton's books haves done a huge disservice in undermining biblical inerrancy. See Hugh Ross' Rescuing Inerrancy for more on Walton and others who aren't too good at biblical study. There's a lot of food for thought in these pages. For more, see and .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 1, 2018
C
Verified Purchase
Chet K
Lowell, US
★★★★★ 5
Great supplement to Bible study
Format: Paperback
Stimulating reading for science-minded and biblically minded readers. The author who wrote this book has a lot to say about some of the strange images we read about in the Bible. Giants, flying reptiles, satyrs, fauns, denizens, angels, demons, etc. Once I read this, I began realizing that much of the strange things we see in the world outside the Bible are about as realistic as some of these images mentioned in the Bible. The battle between our minds and our souls carries on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 26, 2024

recommand products