SKU: 78631241586

CD63 Fc Chimera Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD63 Fc Chimera Protein, HumanProduct Specification Species Human Antigen CD63 Synonyms LAMP 3, MLA1, TSPAN30 Accession P08962 Amino Acid Sequence Ala103 Val203, with C terminal Human IgG Fc

Product Specification


Species Human
Antigen CD63
Synonyms LAMP-3, MLA1, TSPAN30
Accession P08962
Amino Acid Sequence

Ala103-Val203, with C-terminal Human IgG Fc AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

45-50kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.J Biol Chem 2013 Jun28;288(26):19060-71. Epub 2013 Apr 30.

Background

CD63 is a member of the transmembrane-4 glycoprotein superfamily, known as tetraspanins. The tetraspanins contain four transmembrane domains, two extracellular loops flanked by short intracellular N and C termini, and a highly conserved sequence motif within the larger extracellular domain. Tetraspanins interact among themselves and with other transmembrane proteins to form membrane domains denoted tetraspanin-enriched microdomains (TEMs). At least in part through the TEMs, tetraspanins regulate a variety of cellular processes including cell fusion, intracellular trafficking, cell adhesion, motility, invasion, and cell differentiation. CD63 is among the most highly expressed tetraspanins in endothelial cells (ECs). Still, the role of CD63 in endothelial biology and angiogenesis remains to be addressed. We show that CD63 is co-localized with the type I integral lysosomal membrane protein (LAMP-1) but also present on the EC surface. By silencing CD63 expression in primary ECs, we demonstrate that CD63 associated with both β1 integrin and VEGFR2 in the plasma membrane and was required for VEGFR2-β1 integrin complex formation. Loss of CD63 expression disrupted downstream signaling path ways both in endothelial cells in culture and in intact tissues. As a consequence, CD63-deficient ECs failed to engage in sprouting angiogenesis and organize into tube structures.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 78631241586

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
MR
Pawtucket, US
★★★★★ 5
Great for dogs
Color: blue
My dog is obsessed with this! I put plain yogurt thinned with homemade broth in it and he’s entertained for a good 15 minutes, as well as being fairly calm afterward.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
A
Verified Purchase
Alyssa G.
New York, US
★★★★★ 5
Great bowl, would love this in a larger size
Color: blue
This is a great way to treat your dog! I filled it with a bit of plain yogurt drink diluted with water, and my dog absolutely loved it. It only took him about 3-5 minutes to finish it, but he’s about 60lbs, so maybe a bigger size bowl would be better for him. Max capacity of this one is 190 ml. You do have to monitor your dog with this bowl - mine tried to dismantle the bowl when it was empty, trying to get more out of it. Overall I think it’s a fun way to get your dog to drink a little bit more with diluted yogurt, broth, etc.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
A
Verified Purchase
Amazon Customer
Phoenix, US
★★★★★ 5
My dog loves it!
Color: black
Kudos to whomever created this! I have a super attached (med) dog that follows me from room to room alllll day. The first time I put this down he went right for it and didn’t even notice i had left the deck. He is very food driven. I used bone broth and pumpkin puree, which was a hit but once I used the apple sauce… HUGE hit. My only complaint is that it doesn’t come in an XL size. My dog can empty it in under 3 minutes..so he doesn’t get relaxed or sleepy! it does splash out a bit from the top so I use it on his food mat or outside..my sister can’t stand the noise the ball makes. I wasn’t diluting enough so the ball doesn’t move smoothly in the video, but it really does work! The cover is very well made and sturdy. I didn’t notice it sliding around at all. My dog also did not try to get the ball out (loves to tear apart toys) or tip it over, but I could see that happening. I wouldn’t use unsupervised unless you have a small dog. Please make a larger size!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
J
Verified Purchase
Jen
Phoenix, US
★★★★★ 3
Works but the bowl is wacky
Color: blue, Color: blue
This slow feeder is actually a very good idea and my dog likes it. I blend plain, unsweetened yogurt with a little powdered pumpkin & apple pectin and thin it down with water so the roller ball can easily rotate. It's sturdy and it doesn't slip on the floor, which is good. However, I give it only three stars because the bowl inside is a ridiculous design. Instead of the inside surface being a gently sloping, smooth surface, the "legs" underneath protrude up through the inside (see photo). It makes stirring and cleanup much more difficult than it needs to be. Presumably, it's made using injection molding so it should be easy to design it with a smooth finish.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
M
Verified Purchase
Mark Schwenke
Draper, US
★★★★★ 4
Happy licking brain stimulation!
Color: black
We have a very active 1 year old field golden and we needed something else to stimulate her brain. This has worked out beautifully for that. At first she would want to try to pick it up or move it with her paw but a few corrections and training and she’s learned to just lick at it. It stays well planted in the floor and doesn’t tip over. I had to knock it one star for its ease of use and cleaning. The inside bowl has “fins” inside that make it difficult to stir things up and mix together or to clean. Other than that minor gripe we really love it and would buy again. The enjoyment our girl gets out of is definitely worth the money. It’s been through the dishwasher several times and show no signs of wear and tear so it’s well built. Happy licking!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026

recommand products