SKU: 88174246628

EPCR/PROCR Fc Chimera Protein, Mouse

Sale price$445.50 Regular price$495.00
Save 10%

Pay in installments of $123.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EPCR/PROCR Fc Chimera Protein, MouseProduct Specification Species Mouse Antigen EPCR PROCR Synonyms Endothelial cell protein C receptor,Activated protein C receptor, APC receptor, EPCR, PROCR, CD201 Accession Q64695 Amino Acid Sequence Leu18 Ser214, with C terminal Human IgG Fc

Product Specification


Species Mouse
Antigen EPCR/PROCR
Synonyms Endothelial cell protein C receptor,Activated protein C receptor, APC receptor, EPCR, PROCR, CD201
Accession Q64695
Amino Acid Sequence

Leu18-Ser214, with C-terminal Human IgG Fc LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 65-75kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Montes, R. et al. (2012) Thromb. Haemost. 107:815. 2. Bae, J.-S. et al. (2007) Blood 110:3909. 3. Fink, K. et al. (2013) PLoS One 8:e53103. 4. Willcox, C.R. et al. (2012) Nat. Immunol. 13:872. 5. Turner, L. et al. (2013) Nature 498:502.

Background

The endothelial protein C receptor (EPCR), also known as CD201, is an approximately 50 kDa transmembrane glycoprotein expressed on vascular endothelial cells and functions as a negative regulator of thrombosis. EPCR inhibits thrombosis through its interactions with Protein C, activated Protein C (APC), and Coagulation Factors VII, and VIIa. It enhances the activation of Protein C in response to complexes of Thrombin-Thrombomodulin. In humans, a soluble form of EPCR can be produced by alternative splicing or ADAM17/TACE mediated shedding, and this protein inhibits the anti-coagulant activity of APC. EPCR can be degraded on the surface of endothelial cells by Neutrophil Elastase. Activation of EPCR also protects vascular endothelial cells from Thrombin-induced apoptosis.EPCR binds to CD11b/CD18 (Mac-1) on monocytes and mediates monocyte adhesion to the vascular endothelium. In addition, EPCR binds to the antigen receptor on gamma δ T cells, promotes hematopoietic stem cell retention in the bone marrow, and binds to surface proteins of some species of Plasmodium, contributing to pathogenicity in severe malaria.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 88174246628

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kiwi Cove
Alexandria, US
★★★★★ 5
A Must for contemporary military and civilian leaders in national security
Format: Kindle
This is a very very useful work for members of the contemporary national security strategy community. While Hew's reputation as a historian is very high, it is his thoughtful and insightful comments that he makes in the latter chapters that lay out some of the critical challenges facing contemporary military and civilian leaders.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 19, 2016
T
Verified Purchase
Terry Tucker
Waukegan, US
★★★★★ 5
Astoundingly Good
Format: Kindle
This is a must have book. It is, beyond a doubt, the best book I have read on military strategy. The author is clear, provides case examples, and more importantly makes this "readable." I retired with 24 years on active duty and spent 15 more working in PMC's working in austere and conflict environments. THIS book is long overdue.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2014
R
Verified Purchase
Rachel Gollub
Carnegie, US
★★★★★ 5
Thoughtful and deeply insightful
Format: Kindle
Browse not only goes over the current state of the US military in detail, but also ends with concrete and manageable suggestions to fix the major problems. Really good book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 19, 2025
T
Verified Purchase
Thomas M. Magee
Belleville, US
★★★★★ 5
Eye Opening, Thought Provoking and Scary
Format: Hardcover
This book will grab your attention, keep you spell bound and scare the heck out of you. The author was the Chief of Staff under Senator McCain for the Senate Armed Services Committee. This book is about new technology in the defense field and our inability to deal with it. The new technology comes in many forms. There now are missiles that fly 2 or 3 times faster than what is available now. The missiles can reach out many many thousands of miles more, enough to hit America from the other side of the world. Now computers are recently coming out on the market which are smaller and 2 or 3 times faster than previous computers. All of that combines to radically speed up the decision time for war operations. The author calls it the kill chain. The change doesn't stop there. The tactics used by our competitors has radically changed warfare. The examples the author uses comes from Russia. He reviews their invasion of "Little Green Men" in the Ukraine turned warfare upside down. They infiltrated troops into the land. Then they merged with dissent forces already in the country. Then the war stars, but on a small scale. Before you know it Russia grabbed Crimea and neutralized a huge slice of the Ukraine. That was the first time since WWII where borders changed. The last part of the book is the most scary. He relies on his experience in Congress. He cites several examples to show where the bureaucracy is incapable of change. The pressures of on going operations, turf wars, political desires to protect home based companies all have immobilized the bureaucracy. He also cites the case of the Army trying to get a new side arm. It took 17 million to test an off the shelf pistol. The case showed how fear of risk has layered on level after level of control and check. Those levels of course adds costs. That was just one weapons program. Can you imagine what the cost is as you expand that out to really big ticket things like carriers. It leads to the Pentagon to continue buying weapons it doesn't need and use tactics which really come out of WWII. As the Pentagon games go on the world's armies change. I think his point about the bureaucracy caught in a never ending loop also might explain other troubles across the globe. That leads to the scary part. Is the country ready for the future? Will it defend the nation for the future? If it isn't 9/11 might be a match strike in comparison.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2020
S
Verified Purchase
Steve Dietrich
Draper, US
★★★★★ 4
Eyes Wide Open (with a few omissions)
Format: Audiobook
Thought provoking and great insights but with a few material omissions. As others have noted this is an extremely thought provoking book. Perhaps the most disturbing is the discussion of war gaming a war with China and in most every Chinese initiated war China wins. A close runner-up was the lack of widespread commitment of other senate members to be as fully informed as possible on the military side of military affairs including budgets for specific projects. It's hard to document the claim that two issues were serious omissions but I think there were. There are seemingly minor details that are important Robert McNamara worked for Ford not GM. This is important for decisions at Ford by McNamara's accolates took Ford down to one of its smallest market share of the postwar years. McNamara gave Ford the Falcon , his successors brought out the Mustang. His arrogance cost billions and thousands of lives. McCain recognized the political folly of the initial "leased" Boeing Replacement Tanker Program but that is not discussed. Neither is the continuing debacle of the program, felony convictions/pleas of top Boeing execs and the Pentagon's civilian chief of procurement all associated with the ill-fated tanker program. Declared a near emergency need at the turn of the century, twenty later the tankers can not perform the mission and tens of billions over budget. To put the Tanker Program debacle in perspective, In July 1962 the US achieved its first orbital space flight and its first Moon landing 7 years later. In contrast the replacement tanker program has been in process Boeing was awarded the contract in 2002 , 19 years later and the tankers are not fully operational. Along the way both Boeing and a top civilian dod official did some hard time on felony corruption convictions/pleas. The author notes that in the event of an outbreak of war between the US and China the US ships must get far offshore to have even a chance of survival, well beyond the range of existing carrier based aircraft to attack Chinese forces. The lack of tankers, short range attack aircraft and light loads prevents the Navy from going deep inland. Part of the problem is that the Navy was induced to scrap the long range, extremely deadly F-14B and F-14X and replace them with the slower, shorter range , less carrying capacity F-18s (also made by Boeing) . The Navy had available at the time the F-14X upgrade program which would have converted the F-14 to an even more deadly fighter / bomber and equipped them with a follow-on to the Phoenix missiles, so badly needed to defend the fleet against airborne launched cruise missiles. In addition there were further upgrades in the works to give the Phoenix missiles extremely valuable capabilities. A further indication of the suspicious pattern is that DOD required that all F-14 tooling and parts be destroyed. The claim was made that the F-14s were maintenance hogs. Partly true but largely fixed with the F-14X digital conversion and new engines. While the maintenance hours per flight hour were problematical, when looked at in the big picture they were a rounding error in the 6,000 or so sailors in the Battle Group working 10-15 hour days and the thousands onshore supporting the effort. Does this matter, well yesterday the Chinese ran a practice attack on a US carrier as about 15 aircraft approached within 250 nautical miles of the carrier. Most certainly within range to launch enough hypersonic cruise missiles to virtually assure the carrier would be taken out of action or sent to the bottom of the ocean. As the author notes today's strategy requires that the carriers flee the area and standoff about 1,000 miles. Faster, much longer range F-14x aircraft with the next generation Phoenix would significantly reduce this threat. They would also do the same against large Russian aircraft carrying many cruise missiles. The F-35s will help overcome this deficiency but until they are fully operational and our Naval tanker capabilities redeveloped US capabilities are seriously compromised. The author makes many great observations regarding deficiencies in procurement management, in the Pentagon , Congress and White House. Examples discussed include the Army's failed attempt to acquire a new pistol. The 500 page request for proposals and flawed competition would be a joke were in not for the fact that the taxpayers precious dollars were wasted in the failed effort. An illustration of how perverted the situation has become was illustrated today with a note the the US Air Force had issued an RFP for a "modesty curtain" to be installed on our ancient B-52's because there were now female personnel flying missions. This is a need that should be solvable by a few individuals over a bottle of wine who would probably come up with better ideas, reviewed by an engineer on Monday and perhaps fabricated in one of the base shops. As others have noted it was USAF Col John Boyd who revolutionized the air to air combat, was shunned by top Brass while at the Pentagon and left to his own devices prepared his famous day long lecture on Winning and Loosing Wars that in turn helped rewrite the USMC land battle doctrine. Most all of this work done out of sight of his "leaders" . The author might have also given credit to leaders like Admiral Tom Connolly who sacrificed his career to save Naval aviation from the terminally flawed F-111B as an example of the character and courage needed in the Pentagon, Congress and the White House today and into the future. The author's descriptions of the challenges posed by an aggressive and expansive China should be taken to heart by every American. Unless we stop treating military procurement as a Chicago like spoils system and manage both what we buy and what we pay for it we are inviting Chinese military challenges and placing an even greater financial millstone around the necks of American taxpayers and their future generations. Overall , not perfect but a very important must read
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 30, 2021

recommand products