SKU: 84965120781

E-Selectin/CD62E His Tag Protein, Human

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

E-Selectin/CD62E His Tag Protein, HumanProduct Specification Species Human Antigen E Selectin CD62E Synonyms SELE, ELAM1, ESEL, LECAM2 Accession P16581 Amino Acid Sequence Trp22 Pro556, with C terminal 10*His

Product Specification


Species Human
Antigen E-Selectin/CD62E
Synonyms SELE, ELAM1, ESEL, LECAM2
Accession P16581
Amino Acid Sequence

Trp22-Pro556, with C-terminal 10*His

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 80-92kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Evan Ales.The biology of E-selectinligands in leukemogenesis. Adv Cancer Res. 2023;157:229-250

Background

Trp22-Pro556, with C-terminal 10*His

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPGGGSGGGSHHHHHHHHHH

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 84965120781

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Lake Worth, US
★★★★★ 5
Warm base of vanilla, with a bit of spice to keep things interesting! Definitely a keeper!
First, I need to admit that Cremo is one of my “go to” brands for body wash. I love the fact that the scents are high-quality without getting into the weird “axe” arena of being able to be smelled a mile away. The body wash has a fresh, warm, earthy smell to it. Vanilla base with a bit of spice to not make it smell like a sugar cookie. I think you all know those body washes that are just too heavy with the vanilla smell. The price for this level of body wash is spot on for what you get from a quality, moisturizing, and skin care perspective. It doesn’t dry out your skin and even the deep rich color of the gel screams quality. This is a really great new scent from Cremo and one that I’d definitely come back to and keep in my rotation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
S
Verified Purchase
steve
Phoenix, US
★★★★★ 4
Good product but smell doesn't last
Cleans and rinses great, does not dry out your skin. Smell great, not as strong as the Italian Bergamot, nor does it last after showering. Once you dry off, smell pretty much gone. Bergamot lasts a little better
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2025
I
Verified Purchase
Imani S
Whiting, US
★★★★★ 5
Beyond my expectations…
Scent: Incredible 10/10. The entire shower smells like a spa afterwards. Woody notes, vanilla scent is deliciously heavy and warm, and even one pump delivers a punch of fresh vanilla scent to your entire body. I’m a woman who is in love with heavy earthy scents and this is it! P.S it also matches well with scents like vanilla, cocoa butter, chocolate, or even delicious “smore” scents! I pair it with vanilla and cocoa butter scented deodorant, vanilla perfume, or vanilla body lotion and it works amazing! Longevity: Lasts the entire day if I’m staying home just relaxing, not working out or sweating very much. I could shower in the early morning and by the time my head hits the pillow I still smell it faintly! If I’m out and about it still lasts hours I’d estimate around 6-8 hours before the scent fades! If I shower at 6am, come home at 5pm-6pm after work I still smell fresh! (I always shower 2x a day but you don’t even need to with this! Value for Money/Size: Oh absolutely! I think I bought this soap two weeks ago? Used it nearly every day, and you can’t even tell! One pump is enough, two pumps MAX per shower per day. I decided to lavish myself by buying this soap, because it’s a bit more pricey. But it’s actually saving me more money, at this rate I’ll be buying another one of these every 3 months! So that’s…4 times a year? 5 max? That’s incredible. I’ll probably stick with Cremo for life honestly. And I’m a woman!💕🎀
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2026
L
Verified Purchase
Light-Zone
Lexington, US
★★★★★ 5
High Quality and Smells Great!
This is so far superior to the standard soaps that you buy off the shelf in a supermarket. It creates a truly luxurious lather and smells fantastic without being obnoxious or perfume.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
E
Verified Purchase
Ebin buy :D
Pawtucket, US
★★★★★ 5
Best vanilla body wash I've seen
Proper vanilla scent with a kick, without the vomit inducing synthetic aftertaste
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026

recommand products