SKU: 84515025322

Human CD62P, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 23 - Aug 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD62P, His tagProduct Specification Species Human Synonyms CD62 antigen like family member P, Granule membrane protein 140 (GMP 140), Leukocyte endothelial cell adhesion molecule 3 (LECAM3), Platelet activation dependent granule external membrane protein (PADGEM), GMRP, GRMP Accession P16109 Amino Acid Sequence Protein sequence(P16109, Trp42 Ala771 with C 10*His)

Product Specification


Species Human
Synonyms CD62 antigen-like family member P, Granule membrane protein 140 (GMP-140), Leukocyte-endothelial cell adhesion molecule 3 (LECAM3), Platelet activation dependent granule-external membrane protein (PADGEM), GMRP, GRMP
Accession P16109
Amino Acid Sequence

Protein sequence(P16109, Trp42-Ala771 with C-10*His) WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:81.6 kDa Actual:120kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD62P was first identified in endothelial cells in 1989. CD62P is a type-1 transmembrane protein that in humans is encoded by the SELP gene. CD62P functions as a cell adhesion molecule (CAM) on the surfaces of activated endothelial cells, which line the inner surface of blood vessels, and activated platelets. In unactivated endothelial cells, it is stored in granules called Weibel-Palade bodies. In unactivated platelets CD62P is stored in α-granules.P-selectin plays an essential role in the initial recruitment of leukocytes (white blood cells) to the site of injury during inflammation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 84515025322

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
E. Cooper
Cuba, US
★★★★★ 4
Evisceration was nearly instantaneous but he’s hanging on!
Despite my Sunshine eviscerating this prehistoric fellow and extracting the squeaker from his innards within minutes (followed by about an hour of her laying about, lazily squeaking, it has otherwise held up fairly well! Plastic squeaker aside, it doesn’t have any other plastic parts in it and the stitching has held up (my Sunshine went for the squeaker as if it were an alien about to burst forth from the dino’s belly and acted accordingly so the fabric didn’t quite hold up as well). It’s a decent size and only had a bit of fluff in its belly for me to clean up afterward. My Sunshine is an energetic chewer so I consider it a win that this thing is still even dino-shaped and only bereft of its squeaker. My Sunshine is quite happy with this little fellow and if she’s happy, I’m happy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 20, 2025
R
Rob Colvil
Omaha, US
★★★★★ 5
Became my dog's new favorite
This instantly became my dog's go-to toy, and thankfully it's lasted longer than I anticipated. He was excited to play with it immediately, of course, but he also continued to go to it over all the other toys he has. He loves to rip and tear, so I didn't think this would last more than a day, but incredibly it's been going for weeks. Granted, he's torn out the squeaker and some of the crinkly plastic, as well as most of the stuffing, but there's still a recognizable dinosaur-shaped toy hanging around that he still likes to play with. The squeaker is also different than most dog toys, it's larger and lower-pitched, so that variation is fun. There's lots of crinkly plastic in the tail and feet, so even after my dog ripped open the tail and gotten that plastic out, there's still more noise-making stuff left in there. The size and amount of stuffing is also great, as it's given him many days of things to tear apart.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 21, 2025
S
Susan Bewley
Boise, US
★★★★★ 5
My Dogs Love It!
Do your dogs love a specific type of toy? Since my girls were puppies, they have preferred a specific material for toys. It is a soft, bubbly texture, usually in bright colors. It is soft for them and durable enough to survive even the toughest of playmates. All the toys made from this material also have a certain crinkle paper that drives both of my girls wild, and sometimes even include a squeaker. When I saw that this adorable dinosaur fit their favorite toy's qualities, I knew I had to get it for them! First, I want to talk about the quality. This dinosaur is adorable and designed for some tough play sessions. It is more reinforced than the name-brand toys I buy, which impressed me. While my girls rarely destroy toys, I find comfort in knowing that they will likely get bored with a toy before destroying it. What shocked me more was the squeaker. This company didn't go cheap; they went for a higher quality, large squeaker that is very loud and durable. My dogs have been playing with this for nearly two hours straight, and the squeaker has been going strong. If you don't like loud squeakers, though, be warned, it is very loud and isn't stop working anytime soon! Overall, this toy has been a big hit and way cheaper than what I can buy at local pet stores. With the quality and how much my girls love it, it has been a bargain and well worth it! This is a toy that we will be purchasing more of soon.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 9, 2025
S
StacyP
Bozeman, US
★★★★★ 5
Rawr!
My dogs love this toy; they have been playing with it for a few days, and surprisingly, it has been durable enough to withstand most of the torture. it has a fun squeaker and thankfully not too much filler, which I am thankful to have to follow behind to pick up. This is a good value toy. My dogs can usually tear a toy up in seconds but for some reason, they have chosen to keep this dinosaur alive!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 18, 2025
S
snowyh
Louisville, US
★★★★★ 4
Not for Aggressive Chewers
Cute stuffed dino with one large squeaker in the body and crinkle paper in the feet and tail. The right size for medium to large dogs. Riley was eager to play tug-of-war with this toy when I first gave it to her. Five minutes later the novelty had worn off and she went to her toy basket to bring out her usual favorites. Being plush, this is not really a toy for aggressive chewers--after only 5 minutes she had torn open a seam and ripped off part of the tag. I'll continue to let her play with it until stuffing starts coming out (which shouldn't be long).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 13, 2025

recommand products