SKU: 57783255321

Human CD34, hFc tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 22 - Aug 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD34, hFc tagProduct Specification Species Human Accession P28906 Amino Acid Sequence Protein sequence(P28906, Ser32 Thr290, with C hFc)

Product Specification


Species Human
Accession P28906
Amino Acid Sequence

Protein sequence(P28906, Ser32-Thr290, with C-hFc) SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight Theoretical:53.5 kDa Actual:115 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Tag with C-hFc
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD34 is a transmembrane phosphoglycoprotein protein encoded by the CD34 gene in humans, mice, rats and other species. CD34 derives its name from the cluster of differentiation protocol that identifies cell surface antigens. CD34 was first described on hematopoietic stem cells independently by Civin et al. and Tindle et al. as a cell surface glycoprotein and functions as a cell-cell adhesion factor. It may also mediate the attachment of hematopoietic stem cells to bone marrow extracellular matrix or directly to stromal cells. Clinically, it is associated with the selection and enrichment of hematopoietic stem cells for bone marrow transplants.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57783255321

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amy Jo
Omaha, US
★★★★★ 3
Shows wear quickly
Color: Multicolor/Sheep & Cow, Size: Medium
These are cute but not holding up as well as I had hoped. Quality is ok and the Velcro has held up great. The fabric just isn’t as good as it could be. They are much larger than expected.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
R
Verified Purchase
Rachel
Natrona Heights, US
★★★★★ 5
Super Sturdy with hours of fun.
Color: Wild Duck, Hare, Squirrel & Alligator, Size: Small
I got the small ones that you cannot put a water bottle in. These toys have held up way better than expected. I am dog sitting a very rough with toys dog named Chunk. He tears up ever. Single. Toy my dog (Ted) has. I bought new ones just for chunk. These appealed to me with the no stuffing, They were cheaper, and have a squeaker. Everything chunk needed. They arrived on time and I thought I wasted my money. They were super soft, like too soft. They felt flimsy and weak. Like 5 minutes with chunk and they be dead. 2 hours with my dog and they would have a rip. So far 2 of them (I set two out) have lasted the whole weekend. The bunny looks very rough and disgusting, but no rips, the squeakers still work, and no random fluff everywhere. I am going to wash the bunny once chunk leaves. My very careful doggo Ted loves them too. He throws them up in the air and catches them, plays tug of war with them, and no rips. They are super sturdy. He can’t wait until Chunk leaves (chunk is 2 and Ted is 12-13) so he can play with them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
A
Verified Purchase
Amber B.
Phoenix, US
★★★★★ 5
Loved it
Color: Brown/Wild Duck, Size: Large, Color: Brown/Wild Duck, Size: Large
He loved it so much, he destroyed it so we ordered another. I didn't realize that you can stick an empty water bottle inside. Again, the first one didn't last long, but he enjoyed it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
D
Verified Purchase
Doug Jones
Lexington, US
★★★★★ 5
Very fun interactive toy
Color: Brown/Wild Duck, Size: Medium
This toy is very versatile. There's no stuffing yet it's very soft so it can be used as a tug toy. It also makes for a fun fetch toy because it has a cavity to put a water bottle. It gives your dog something that crinkles and can be pierced when bitten and easily replaced with another empty bottle whenever necessary. That is what really makes this toy the standout of all the ones offered by Best Pet imo. I don't expect this to last forever but once my pup gets bigger we'll probably get the large size for her because there's not too many all in one fetch and tug toys at an affordable price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
C
Verified Purchase
Cowey Crew
Waukegan, US
★★★★★ 4
Great Toy, but Big Dogs Destroy the Squeakers Fast
Color: Wild Duck, Hare, Squirrel & Alligator, Size: Large
My big dogs had the squeaker torn out in no time, but my little dog absolutely loves this toy. It’s the perfect size for her, and she carries it everywhere. Durable enough for small pups, just not tough enough for heavy chewers. Still a fun toy overall!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026

recommand products