SKU: 83677819918

Human LECT2, His tag

Sale price$175.50 Regular price$195.00
Save 10%

Pay in installments of $48.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human LECT2, His tagProduct Specification Species Human Synonyms Leukocyte cell derived chemotaxin 2, LECT 2, hLECT2 Accession O14960 Amino Acid Sequence Protein sequence (O14960, Gly19 Leu151, with C 10*His) GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 16. 3 kDa Observed MW: 18 kDa Purity 95% by SDS PAGE

Product Specification


Species Human
Synonyms Leukocyte cell-derived chemotaxin-2, LECT-2, hLECT2
Accession O14960
Amino Acid Sequence

Protein sequence (O14960, Gly19-Leu151, with C-10*His) GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 16.3 kDa Observed MW: 18 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Leukocyte cell-derived chemotaxin-2 (LECT2) is a chemotactic factor for neutrophils. Subsequent studies have defined LECT2 as a hepatokine. LECT is an evolutionary conserved protein, has one or more important functions, and may be involved in various diseases. Human LECT2 is a secreted, 16 kilodalton protein. Its structure is similar to that of the M23 family of metalloendopeptidases. LECT2 has not been found to possess enzymatic activity and does not appear to share any functions with M23 metalloendopeptidases. The liver hepatocyte is considered to be the source of the LECT2 circulating in blood. Several cell types or tissues, e.g. osteoblasts, chondrocytes, cardiac tissue, gastrointestinal smooth muscle cells, and epithelial cells of some tissues normally do not express LECT2 but do so under a variety of disease conditions. LECT2 amyloidosis (ALECT2) was the common (~3% of total) cause of amyloidosis. Circulating levels of LECT2 are elevated in >90% of individuals with hepatoblastoma and >20% of individuals with Hepatocellular carcinoma. In the latter form of liver cancer, LECT2 levels increase with increasingly poor prognostic stages of the disease and therefore may prove to be valuable prognostic markers.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 83677819918

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LS
Charlottesville, US
★★★★★ 5
Great Divider
Comes assembled. It is heavy, but fairly easy to move and use. I’m 5’4, 110 and I can do it myself. It’s thick, it’s tall, it looks good, not sloppy or cheap. Doesn’t smell. Great room divider. We use it for our office between our desks.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 27, 2025
R
Verified Purchase
RS
Waukegan, US
★★★★★ 5
Good purchase
Color: White, Size: 8 Panel
I bought this in white for use in a finished basement to hide equipment on the wall and create a nice space to place a bed. Because it doesn’t need to be moved and the room is temperature controlled, I expect it to last for a long time. The screen is pretty and I like that the woven material is not easily breakable. I’m pleased with the purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 26, 2025
S
Verified Purchase
Swathi
Cuba, US
★★★★★ 4
Quality is good
Color: Black, Size: 6 Panel
Good one. Some support need for it to stand
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 28, 2026
S
Verified Purchase
Shabree
Port Orchard, US
★★★★★ 5
Very nice for the price
Color: Natural, Size: 8 Panel
I use this to hide my cat area in our garage. Makes it look clean
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2026
N
Verified Purchase
NA
Dallas, US
★★★★★ 5
Perfect & light weight divider
Color: Charcoal Gray, Size: 8 Panel
I really like this divider. I have it in my bedroom which is also where my "work from home office" is. The divider blocks my bedroom and dresser perfectly. It's very light weight and very easy to move.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2026

recommand products