SKU: 65008202486

Human LECT2, His tag

Sale price$175.50 Regular price$195.00
Save 10%

Pay in installments of $48.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human LECT2, His tagProduct Specification Species Human Synonyms Leukocyte cell derived chemotaxin 2, LECT 2, hLECT2 Accession O14960 Amino Acid Sequence Protein sequence (O14960, Gly19 Leu151, with C 10*His) GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 16. 3 kDa Observed MW: 18 kDa Purity 95% by SDS PAGE

Product Specification


Species Human
Synonyms Leukocyte cell-derived chemotaxin-2, LECT-2, hLECT2
Accession O14960
Amino Acid Sequence

Protein sequence (O14960, Gly19-Leu151, with C-10*His) GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 16.3 kDa Observed MW: 18 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Leukocyte cell-derived chemotaxin-2 (LECT2) is a chemotactic factor for neutrophils. Subsequent studies have defined LECT2 as a hepatokine. LECT is an evolutionary conserved protein, has one or more important functions, and may be involved in various diseases. Human LECT2 is a secreted, 16 kilodalton protein. Its structure is similar to that of the M23 family of metalloendopeptidases. LECT2 has not been found to possess enzymatic activity and does not appear to share any functions with M23 metalloendopeptidases. The liver hepatocyte is considered to be the source of the LECT2 circulating in blood. Several cell types or tissues, e.g. osteoblasts, chondrocytes, cardiac tissue, gastrointestinal smooth muscle cells, and epithelial cells of some tissues normally do not express LECT2 but do so under a variety of disease conditions. LECT2 amyloidosis (ALECT2) was the common (~3% of total) cause of amyloidosis. Circulating levels of LECT2 are elevated in >90% of individuals with hepatoblastoma and >20% of individuals with Hepatocellular carcinoma. In the latter form of liver cancer, LECT2 levels increase with increasingly poor prognostic stages of the disease and therefore may prove to be valuable prognostic markers.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65008202486

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
HEATHER H
Los Angeles, US
★★★★★ 5
Cruise
Size: 8 Ounce (Pack of 1), Style: Cool Down Lotion
Smells great just as described
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
S
Verified Purchase
Shawshank
Chelsea, US
★★★★★ 5
Works Exceptionally well without feeling like you just applied Super Glue to your Body.
Size: 8 Ounce (Pack of 1), Style: Cool Down Lotion
I would provide a picture of the bottle but TSA took mine. This is some of the best post sunburn lotion I have ever used. I just finished writing a review of a sunblock lotion that did a great job, what I did not mention was the only sunburn I got was on my lower back where I didn't apply that lotion. It was a pretty uncomfortable burn, especially when I tried to sleep in the forward berth of a sailboat, or when I tried to wear swimming trunks with an elastic type waist, thankfully I had a couple of sets of board shorts that alleviated that irritation. But back on point. What I like the most about this lotion is how it applies. Usually, in the past, I did not like using aloe lotions because I felt like it was like glue when it dried on my skin and I felt like it made my skin feel tight. This stuff applies extremely well and I'm not exaggerating one bit when I say the relief is IMMEDIATE. As soon as I applied it to my sunburn, I felt immediate relief! It also doesn't feel like you just spread a bunch of super glue on your burn when it dries. It absorbs into your skin, cools your "hot spot" and doesn't leave a residue to get onto your clothing, or onto the mattress in my berth on the sailboat. Win and win. I can't recommend this product enough. The only negative experience was when TSA snagged my bottle going through security in Miami because I forgot to put it in my checked bag. But that was just the good ol' TSA doing their job in the amazing way they always do. (sarcasm dripping sounds) It works so well that I bought a replacement. So I would recommend purchasing the 3 oz tube if you plan on traveling with it. This is an excellent product, I'm not sure how long it lasts, because I forgot my sunburn was nothing me, or it enabled me to fall back asleep after applying. It does have that coconutty smell, but it's not like I just spent 3 hours in a hot tub filled with coconut oil. Hmmm... Idea forming... Anyway, purchase with confidence, this Texan who got a sunburn on his lower back and treated it with Sun Bum approves this message.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 27, 2021
J
Verified Purchase
Jen
West Palm Beach, US
★★★★★ 5
Perfect Little Sun Care Kit — Great for Travel!
Style: Original, Style: Original
I love this Sun Bum Road Tripper set! The travel‑sized products are perfect for tossing into my beach bag or carry‑on, and everything smells amazing. It has all the essentials you need for a day in the sun without taking up a ton of space. The quality is exactly what you expect from Sun Bum — gentle, effective, and reliable. This is such a convenient little kit for trips, beach days, or keeping in the car. Definitely a must‑have for anyone who loves being outdoors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
M
Verified Purchase
Michele Cox
Battle Creek, US
★★★★★ 5
Convienent and necessary
Style: Original
Perfect addition to my backpack for a Disney trip! Loved the bag!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
C
Verified Purchase
Crazydogcatlady
San Leandro, US
★★★★★ 5
Travel size products, best sunscreen out there.
Style: Original, Style: Original
Great as always but picture is misleading a bit, this is the small travel size bottle not the full size. I should have read better, still like the set nonetheless of course. Heres a picture for comparison.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026

recommand products