SKU: 8240806257

Mouse CD105, His tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 9 - Sep 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD105, His tagProduct Specification Species Mouse Synonyms Cell surface MJ7 18 antigen, Edg Accession Q63961 Amino Acid Sequence Protein sequence (Q63961, Glu27 Gly581, with C 10*His)

Product Specification


Species Mouse
Synonyms Cell surface MJ7/18 antigen, Edg
Accession Q63961
Amino Acid Sequence

Protein sequence (Q63961, Glu27-Gly581, with C-10*His) ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSGKGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 61.7 kDa Observed MW: 75 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Endoglin (ENG) is a type I membrane glycoprotein located on cell surfaces and is part of the TGF beta receptor complex. It is also commonly referred to as CD105, END, FLJ41744, HHT1, ORW and ORW1. It has a crucial role in angiogenesis, therefore, making it an important protein for tumor growth, survival and metastasis of cancer cells to other locations in the body. It is involved in modulating a response to the binding of TGF-beta1, TGF-beta3, activin-A, BMP-2, BMP-7 and BMP-9. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 8240806257

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Grom kid
Alexandria, US
★★★★★ 4
Great product and price
Size: 3 Set 3-Tier, Planks Not Included
Nice quality product Great product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
T
Verified Purchase
Tiffany Lopez
Carnegie, US
★★★★★ 5
Worth the money!
Size: 3 Set 3-Tier, Planks Not Included, Size: 3 Set 3-Tier, Planks Not Included
Such a good buy! High quality and easy to assemble. I will warn that hanging them is a little tricky (We read several reviews saying this and thought “they’re just dumb”, we were definitely wrong. I recommend installing/ attaching the middle level of plates first before attaching the tops and bottoms. It just made it easier for us to keep everything level throughout the process) but other than that very happy with this purchase! We hung three 12 inch boards inside and it added SO much storage and looks so nice! Definitely worth the money!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 18, 2025
J
Verified Purchase
Jana
Houston, US
★★★★★ 5
Takes up a lot of visual space
Size: 3 Set 4-Tier, Planks Not Included
Great product. Goes together easily and quickly. Everything was there that was needed. Looks great and is consistent with my industrial look; however, we're converting a stairwell to the basement to a pantry and wanted to use these shelves there. It takes up an inordinate anount of visual space and made it feel claustrophobic to me. I tried to come up with someplace to use it, but it's a very small house. If you have the space, you won't be disappointed with these shelves.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 18, 2025
R
Verified Purchase
Rosa ferrell
Alexandria, US
★★★★★ 5
Nice sturdy shelf
Size: 3 Set 4-Tier, Planks Not Included, Size: 3 Set 4-Tier, Planks Not Included
I really love my shelf. It is nice and sturdy. I use it in my salon studio.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
I
Verified Purchase
Infinity
Alexandria, US
★★★★★ 5
Used in our bakery/coffee shop
Size: 2 Set 5-Tier, Planks Not Included, Size: 2 Set 5-Tier, Planks Not Included
We ordered the 5 tier set to use in our bakery/coffee shop. We used eight 4’ planks and one 12’ plank along the top. Couldn’t be more pleased with how it turned out. Very easy to assemble and high quality for the price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026

recommand products